LXL04_029617 | RubberDandelionOmics

Gene overview

LXL04_029617

Reference: OH-1004 Chr: Chr06 Coordinates: 95516188-95518812 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1458 bp · LXL04_029617|LXL04_029617|OH1004|cDNA

ATGGGGTGCGATTTTTCAAAAATGTGTTCGTGTTGCGATACCGTACAAGATGGAGTGGTAGCTGACCCTGGTAATGTTGAAAATGAAATGGGGGAGGCAAGTGATTTGCCAGCATTTCGTGAATTTACTGTTGATCAATTAAGGAATGCGACATCTGGATTTGCAGTTGAAAACATAGTTTCAGAACATGGTGAAAAAGCCCCAAATGTTGTGTATAAAGGGAAGTTGGCAAATCAAAGGCGAATTGCTGTCAAAAGGTT...

CDS

Download CDS FASTA

1458 bp · LXL04_029617|LXL04_029617|OH1004|CDS

ATGGGGTGCGATTTTTCAAAAATGTGTTCGTGTTGCGATACCGTACAAGATGGAGTGGTAGCTGACCCTGGTAATGTTGAAAATGAAATGGGGGAGGCAAGTGATTTGCCAGCATTTCGTGAATTTACTGTTGATCAATTAAGGAATGCGACATCTGGATTTGCAGTTGAAAACATAGTTTCAGAACATGGTGAAAAAGCCCCAAATGTTGTGTATAAAGGGAAGTTGGCAAATCAAAGGCGAATTGCTGTCAAAAGGTT...

Protein

Download Protein FASTA

485 aa · LXL04_029617|LXL04_029617|OH1004|PROTEIN

MGCDFSKMCSCCDTVQDGVVADPGNVENEMGEASDLPAFREFTVDQLRNATSGFAVENIVSEHGEKAPNVVYKGKLANQRRIAVKRFNRSAWPDSRQFLEEARTVGQLRSPRLANLLGCCCEGDERLLIAEFMPHETLAKHLFHWETQPMKWAMRLRVALYLAEALEYCTSKGRALYHDLNAYRIVFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVMYSFGTLLLDLLSGKHIPPSHALDLIRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029617`
TK1151 ID	TkA07G329010
OH-1004 ID	LXL04_029617
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.881 / OH-1004 54.639 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029617

Location Chr06:95516188-95518812 (-)

Description Similar to BSK7: Serine/threonine-protein kinase BSK7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63500`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	No verified direct reference in this release
`At5g41260`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175 A kinase-phosphatase signaling module with BSK8 and BSL2 involved in regulation of sucrose-phosphate synthase.2014 · DOI: 10.1021/pr5003164
`At4g00710`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973 BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175
`At5g59010`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	A mutation in Arabidopsis BSK5 encoding a brassinosteroid-signaling kinase protein affects responses to salinity and abscisic acid.2012 · DOI: 10.1016/j.bbrc.2012.08.118

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0684200`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of BRI1.	OsBRI1 Activates BR Signaling by Preventing Binding between the TPR and Kinase Domains of OsBSK3 via Phosphorylation.2016 · DOI: 10.1104/pp.15.01668

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029617 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G63500

ath:AT4G00710

ath:AT5G41260

ath:AT5G59010

dosa:Os04g0684200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.619

Rank 1 · LXL04_029617 · OH-1004

Cytoplasm0.242

Rank 2 · LXL04_029617 · OH-1004

Nucleus0.220

Rank 3 · LXL04_029617 · OH-1004

Endoplasmic reticulum0.046

Rank 4 · LXL04_029617 · OH-1004

Golgi apparatus0.035

Rank 5 · LXL04_029617 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr70-308 aa

PF00069.32Pkinase70-305 aa

PF25575.1TPR_BSK1_C339-456 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029617	`PF07714.24`	PK_Tyr_Ser-Thr	70	308	3.1e-26	92.9
LXL04_029617	`PF00069.32`	Pkinase	70	305	3.9e-22	79.6
LXL04_029617	`PF25575.1`	TPR_BSK1_C	339	456	6.3e-58	194.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I3M3`	Arabidopsis thaliana	Serine/threonine-protein kinase BSK7	78.208%	Swiss-Prot	strong database homology
`Q9FHD7`	Arabidopsis thaliana	Serine/threonine-protein kinase BSK8	76.337%	Swiss-Prot	strong database homology
`Q8W4L3`	Arabidopsis thaliana	Serine/threonine-protein kinase BSK3	74.897%	Swiss-Prot	strong database homology
`Q9FIL1`	Arabidopsis thaliana	Serine/threonine-protein kinase BSK5	73.191%	Swiss-Prot	strong database homology
`B9FDE0`	Oryza sativa subsp. japonica	Probable serine/threonine-protein kinase BSK3	74.949%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card