RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G321450
Reference: TK1151 Chr: Chr07 Coordinates: 80499315-80503252 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1111 bp · TkA07G321450|TK1151|cDNA

TTCTCTCTCTATATAACTCCATACCACAACCATATAACATCTCATCCCCCTCGTCTCATTTCAGCTACAAACACACACTCCACTAAATTGATTCTTCGCCATGGTTTCATCAGAATTCGCCCGCACAGCAGTCGGCATCATCGGAAATGTCATTGCTCTCATCTTGTTCTTATCTCCTGTGCCGACATTCATACAAATTGTGAAGAAAGGATCGGTGGAGCAATTCTCGGCGGTGCCGTACCTTGCGACGTTCATAAACT...

CDS

Download CDS FASTA

753 bp · TkA07G321450|TK1151|CDS

ATGGTTTCATCAGAATTCGCCCGCACAGCAGTCGGCATCATCGGAAATGTCATTGCTCTCATCTTGTTCTTATCTCCTGTGCCGACATTCATACAAATTGTGAAGAAAGGATCGGTGGAGCAATTCTCGGCGGTGCCGTACCTTGCGACGTTCATAAACTGCGGAATATGGATATTGTACGGGCTTCCGGTGGTCCATCCTCACAGCCTCTTGGTCATCACAATCAACGGCACAGGTTTCGTGATCGAGACTGTATACCT...

Protein

Download Protein FASTA

250 aa · TkA07G321450|TK1151|PROTEIN

MVSSEFARTAVGIIGNVIALILFLSPVPTFIQIVKKGSVEQFSAVPYLATFINCGIWILYGLPVVHPHSLLVITINGTGFVIETVYLLLFLIYSDRKQRIKVLLIAVAELVFLGVLSALVLTVAHTTKVRSDIVGSIAIVGNIMMYAAPLSVMKLVITTKSVEYMPFFLSLFSTLNGISWTIYALIRFDPYIVIPNGLGSLLGVTQLILYAAFYKSTKRQMAERKANAEMGLAETVGPTKISNVAHNDHP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G321450
TK1151 IDTkA07G321450
OH-1004 IDLXL04_029496
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.200
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G321450
LocationChr07:80499315-80503252 (-)
DescriptionSimilar to SWEET7: Bidirectional sugar transporter SWEET7
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g10850 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2X3S3 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
Os02g0301100 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
Os01g0605700 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
UniProt: A2WSD8 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0008643 carbohydrate transport Biological Process
GO:0051260 protein homooligomerization Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0016020 membrane Cellular Component
GO:0051119 sugar transmembrane transporter activity Molecular Function
KEGG gene cross-reference
ath:AT4G10850
dosa:Os01g0605700
dosa:Os01g0606000
dosa:Os02g0301100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.804
Rank 1 · TkA07G321450 · TK1151
Cytoplasm0.104
Rank 2 · TkA07G321450 · TK1151
Endoplasmic reticulum0.070
Rank 3 · TkA07G321450 · TK1151
Lysosome / Vacuole0.064
Rank 4 · TkA07G321450 · TK1151
Golgi apparatus0.046
Rank 5 · TkA07G321450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30622DUF86765-34 aa
PF03083MtN3_slv11-97 aa
PF30622DUF8676103-116 aa
PF19683DUF6185114-162 aa
PF03083MtN3_slv133-217 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G321450PF30622DUF86765340.2911.8
TkA07G321450PF03083MtN3_slv11972.4e-48162.8
TkA07G321450PF30622DUF86761031160.2911.8
TkA07G321450PF19683DUF61851141620.319.8
TkA07G321450PF03083MtN3_slv1332172.4e-48162.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8LBF7Arabidopsis thalianasp|Q8LBF7|SWET7_ARATH Bidirectional sugar transporter SWEET757.700%Swiss-ProtHigh
A2X3S3Oryza sativa subsp. indicasp|A2X3S3|SWET4_ORYSI Bidirectional sugar transporter SWEET463.100%Swiss-ProtHigh
Q6K4V2Oryza sativa subsp. japonicasp|Q6K4V2|SWET4_ORYSJ Bidirectional sugar transporter SWEET463.100%Swiss-ProtHigh
Q8W0K2Oryza sativa subsp. japonicasp|Q8W0K2|SWT6B_ORYSJ Bidirectional sugar transporter SWEET6b54.700%Swiss-ProtHigh
A2WSD8Oryza sativa subsp. indicasp|A2WSD8|SWT6A_ORYSI Bidirectional sugar transporter SWEET6a54.200%Swiss-ProtHigh

JBrowse

View in Genome Browser