LXL04_029496 | RubberDandelionOmics

Gene overview

LXL04_029496

Reference: OH-1004 Chr: Chr06 Coordinates: 92365816-92369395 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

753 bp · LXL04_029496|LXL04_029496|OH1004|cDNA

ATGGTTTCATCAGAATTCGCCCGCACAGCAGTCGGCATCATCGGAAATGTCATTGCTCTCATCTTGTTCTTATCTCCTGTGCCGACATTCATACAAATTGTGAAGAAAGGATCGGTGGAGCAATTCTCGGCGGTGCCGTACCTTGCGACGTTCATAAACTGCGGAATATGGGTATTGTACGGGCTTCCGGTTGTCCATCCTCACAGCCTCTTGGTCATCACAATCAACGGCACAGGTTTCGTGATCGAGACTGTATACCT...

CDS

Download CDS FASTA

753 bp · LXL04_029496|LXL04_029496|OH1004|CDS

ATGGTTTCATCAGAATTCGCCCGCACAGCAGTCGGCATCATCGGAAATGTCATTGCTCTCATCTTGTTCTTATCTCCTGTGCCGACATTCATACAAATTGTGAAGAAAGGATCGGTGGAGCAATTCTCGGCGGTGCCGTACCTTGCGACGTTCATAAACTGCGGAATATGGGTATTGTACGGGCTTCCGGTTGTCCATCCTCACAGCCTCTTGGTCATCACAATCAACGGCACAGGTTTCGTGATCGAGACTGTATACCT...

Protein

Download Protein FASTA

250 aa · LXL04_029496|LXL04_029496|OH1004|PROTEIN

MVSSEFARTAVGIIGNVIALILFLSPVPTFIQIVKKGSVEQFSAVPYLATFINCGIWVLYGLPVVHPHSLLVITINGTGFVIETVYLLLFLIYSDRKQRIKVLLIAVAELVFLGVLSALVLTVAHTTKVRSDIVGSIAIVGNIMMYAAPLSVMKLVITTKSVEYMPFFLSLFSTLNGISWTIYALIRFDPYIVIPNGLGSLLGVTQLILYAAFYKSTKRQMAERKANAEMGLAETVGPTKINNVAHNDHP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029496`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029496

Location Chr06:92365816-92369395 (+)

Description Similar to SWEET7: Bidirectional sugar transporter SWEET7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10850`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0301100`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`UniProt: A2X3S3`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os01g0605700`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os01g0606000`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029496 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008643 carbohydrate transport Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0051119 sugar transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G10850

dosa:Os01g0605700

dosa:Os01g0606000

dosa:Os02g0301100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.804

Rank 1 · LXL04_029496 · OH-1004

Cytoplasm0.105

Rank 2 · LXL04_029496 · OH-1004

Endoplasmic reticulum0.069

Rank 3 · LXL04_029496 · OH-1004

Lysosome / Vacuole0.064

Rank 4 · LXL04_029496 · OH-1004

Golgi apparatus0.046

Rank 5 · LXL04_029496 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083.22MtN3_slv11-97 aa

PF03083.22MtN3_slv133-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029496	`PF03083.22`	MtN3_slv	11	97	3.2e-48	162.4
LXL04_029496	`PF03083.22`	MtN3_slv	133	217	3.2e-48	162.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBF7`	Arabidopsis thaliana	Bidirectional sugar transporter SWEET7	57.724%	Swiss-Prot	strong database homology
`Q6K4V2`	Oryza sativa subsp. japonica	Bidirectional sugar transporter SWEET4	59.592%	Swiss-Prot	strong database homology
`A2X3S3`	Oryza sativa subsp. indica	Bidirectional sugar transporter SWEET4	59.592%	Swiss-Prot	strong database homology
`Q8W0K2`	Oryza sativa subsp. japonica	Bidirectional sugar transporter SWEET6b	54.783%	Swiss-Prot	strong database homology
`Q8LR09`	Oryza sativa subsp. japonica	Bidirectional sugar transporter SWEET6a	54.348%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card