TkA07G307460 | RubberDandelionOmics

Gene overview

TkA07G307460

Reference: TK1151 Chr: Chr07 Coordinates: 77173447-77177157 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1373 bp · TkA07G307460|TK1151|cDNA

TTCTTCCAATACCTCCCATCTTTATTTATTGCTAGACTTTTTAACTTTTCTTAGACAGTTTTAGTCGATTAGTAAAACAATGTCCCCTTTCCTGAGTGAGTTAAGGCGCTTCAGAATCCCCCTACAAACCATACAAAACGCCACCAACAACTTTGATGAATCCAACCTCATCGGGCAAGGTGAATTTAGTAAAGTATACAAAGGGGAGTTCTCACACTCTCAGGGTCAAACCATAGTTGCTGTAAAGCGCTGGTCAGTAG...

CDS

Download CDS FASTA

675 bp · TkA07G307460|TK1151|CDS

ATGGCGCCCCCAGCCGTCACCACCACTTTGGTCACTCCGAAGAGCAACCCACCGATCCTTAGGAACCCCCGGACAACTGGGGTAAACCCGGATGCATCACCCCAGGATTCGAACCTGAGACCTCCACTAGGGAAGCCCAGGAAGATAGCCAAACGACCTGGAGATCACTTGCAACTAGCGTTACACTTTGATATCAAAAGTGCCAACATCTTGTTGGACGAAAACTTGAATTCCAAAATTTCAGATATTGGCTTTTATAA...

Protein

Download Protein FASTA

224 aa · TkA07G307460|TK1151|PROTEIN

MAPPAVTTTLVTPKSNPPILRNPRTTGVNPDASPQDSNLRPPLGKPRKIAKRPGDHLQLALHFDIKSANILLDENLNSKISDIGFYKYGTATRNGSYIFSQVKGTLGYVDPVFLETMIYTKESDVYSFGVVLLEVLCSRLCINKSYHDRDNRRYLVEWVKKSSKKVIRDEIIDSNLSQQMETDSFNTFVKLALQCVEKKPKHRPSMDLVVRTLESALKNQETSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G307460`
TK1151 ID	TkA07G307460
OH-1004 ID	LXL04_017727
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.200
Protein coverage (%)	TK1151 74.107 / OH-1004 20.839 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G307460

Location Chr07:77173447-77177157 (+)

Description Similar to KIN5D: Kinesin-like protein KIN-5D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At5g54380`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	A receptor-like kinase mediates the response of Arabidopsis cells to the inhibition of cellulose synthesis.2007 · DOI: 10.1016/j.cub.2007.05.018 Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017727 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0051231 spindle elongation Biological Process

GO:0090307 mitotic spindle assembly Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005819 spindle Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005876 spindle microtubule Cellular Component

KEGG gene cross-reference

ath:AT2G28620

dosa:Os05g0117798

nta:107774014

osa:9268593

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.432

Rank 1 · TkA07G307460 · TK1151

Cell membrane0.304

Rank 2 · TkA07G307460 · TK1151

Nucleus0.282

Rank 3 · TkA07G307460 · TK1151

Endoplasmic reticulum0.068

Rank 4 · TkA07G307460 · TK1151

Mitochondrion0.043

Rank 5 · TkA07G307460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase57-210 aa

PF07714PK_Tyr_Ser-Thr61-213 aa

PF00568WH1145-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G307460	`PF00069`	Pkinase	57	210	6.6e-20	72.3
TkA07G307460	`PF07714`	PK_Tyr_Ser-Thr	61	213	3.7e-15	56.7
TkA07G307460	`PF00568`	WH1	145	189	0.22	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	42.700%	Swiss-Prot	Medium
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	43.300%	Swiss-Prot	Medium
`Q9LK35`	Arabidopsis thaliana	sp\|Q9LK35\|THE1_ARATH Receptor-like protein kinase THESEUS 1	40.400%	Swiss-Prot	Medium
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	39.900%	Swiss-Prot	Medium
`Q9SR05`	Arabidopsis thaliana	sp\|Q9SR05\|ANX1_ARATH Receptor-like protein kinase ANXUR1	38.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card