LXL04_017727 | RubberDandelionOmics

Gene overview

LXL04_017727

Reference: OH-1004 Chr: Chr04 Coordinates: 408868-414287 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2364 bp · LXL04_017727|LXL04_017727|OH1004|cDNA

ATGGAAAAGTTACATAATGTTGTGAACATAGAAAGAACTATGGAGAAAAGAGTCCCGATCTCACCATCAAACACCTCAAGATCCATTGATAAGACAGCAAGAGAAATCCGAGCAGGAGAAGTACAATCAAATGGTAAACATGATAGAGAAAAAGGTGTTAATGTTCAAGTCATTGTCCGATGCAGACCATTGAGTAATGATGAAACGAAAGCACACACTCCAGTAGTTATCACATGTACTGAAAACAAGAAAGAGGTTAG...

CDS

Download CDS FASTA

2364 bp · LXL04_017727|LXL04_017727|OH1004|CDS

ATGGAAAAGTTACATAATGTTGTGAACATAGAAAGAACTATGGAGAAAAGAGTCCCGATCTCACCATCAAACACCTCAAGATCCATTGATAAGACAGCAAGAGAAATCCGAGCAGGAGAAGTACAATCAAATGGTAAACATGATAGAGAAAAAGGTGTTAATGTTCAAGTCATTGTCCGATGCAGACCATTGAGTAATGATGAAACGAAAGCACACACTCCAGTAGTTATCACATGTACTGAAAACAAGAAAGAGGTTAG...

Protein

Download Protein FASTA

787 aa · LXL04_017727|LXL04_017727|OH1004|PROTEIN

MEKLHNVVNIERTMEKRVPISPSNTSRSIDKTAREIRAGEVQSNGKHDREKGVNVQVIVRCRPLSNDETKAHTPVVITCTENKKEVSVFQNIASKQIDRSFVFDKVFGPNTQQRDLYHAAVSPIVFEVLEGYNCTIFAYGQTGTGKTYTMEGGGRKKNGEFPSDAGVIPRAVGQIFDTLEALNAEYDIKVTFLELYNEEIIDLLVVEETSKSPYKPIALMEDGKGGVFIRGLEEEIVSTADEIYKILEKGSAKRRTAETL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017727`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017727

Location Chr04:408868-414287 (-)

Description Similar to KIN5D: Kinesin-like protein KIN-5D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45850`	Responsible for microtubule translocation.	No verified direct reference in this release
`At2g28620`	Responsible for microtubule translocation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0117798`	Responsible for microtubule translocation.	No verified direct reference in this release
`Os08g0558400`	Responsible for microtubule translocation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017727 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0051231 spindle elongation Biological Process

GO:0090307 mitotic spindle assembly Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005819 spindle Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005876 spindle microtubule Cellular Component

KEGG gene cross-reference

ath:AT2G28620

dosa:Os05g0117798

nta:107774014

osa:9268593

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.647

Rank 1 · LXL04_017727 · OH-1004

Nucleus0.284

Rank 2 · LXL04_017727 · OH-1004

Cell membrane0.182

Rank 3 · LXL04_017727 · OH-1004

Golgi apparatus0.054

Rank 4 · LXL04_017727 · OH-1004

Mitochondrion0.050

Rank 5 · LXL04_017727 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796.12Microtub_bd54-204 aa

PF00225.30Kinesin60-392 aa

PF00069.32Pkinase498-766 aa

PF07714.24PK_Tyr_Ser-Thr499-769 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017727	`PF16796.12`	Microtub_bd	54	204	3.1e-26	92.9
LXL04_017727	`PF00225.30`	Kinesin	60	392	2.7e-112	375.7
LXL04_017727	`PF00069.32`	Pkinase	498	766	7.1e-41	141.0
LXL04_017727	`PF07714.24`	PK_Tyr_Ser-Thr	499	769	5.1e-44	151.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZU5`	Arabidopsis thaliana	Kinesin-like protein KIN-5D	76.854%	Swiss-Prot	moderate database homology
`F4IIS5`	Arabidopsis thaliana	Kinesin-like protein KIN-5A	75.000%	Swiss-Prot	moderate database homology
`Q5W7C6`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-5A	69.130%	Swiss-Prot	moderate database homology
`B7EJ91`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-5C	70.290%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card