TkA07G305520 | RubberDandelionOmics

Gene overview

TkA07G305520

Reference: TK1151 Chr: Chr07 Coordinates: 76681663-76682639 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · TkA07G305520|TK1151|cDNA

ATGTACCATGGCTATGTACCGAGTCCATGGACCCACGCCCATGCGACATTTTATGGAAATGAGAGTGCATCTGAAACCATGGGAGGTGCTTGTGGTTATGGAAACTTGATTACTAATGGATATGGGACAGATACAGCTGCATTGAGCTCAACGATCTTTAGCGACGGATATGCATGTGGACAGTGTTACCAAATACGGGTACCATGCAATGCCATTCGGAAAGGTGGAATCAAATTCTCTTTTCAAGGAAATGGTTACTG...

CDS

Download CDS FASTA

591 bp · TkA07G305520|TK1151|CDS

ATGTACCATGGCTATGTACCGAGTCCATGGACCCACGCCCATGCGACATTTTATGGAAATGAGAGTGCATCTGAAACCATGGGAGGTGCTTGTGGTTATGGAAACTTGATTACTAATGGATATGGGACAGATACAGCTGCATTGAGCTCAACGATCTTTAGCGACGGATATGCATGTGGACAGTGTTACCAAATACGGGTACCATGCAATGCCATTCGGAAAGGTGGAATCAAATTCTCTTTTCAAGGAAATGGTTACTG...

Protein

Download Protein FASTA

196 aa · TkA07G305520|TK1151|PROTEIN

MYHGYVPSPWTHAHATFYGNESASETMGGACGYGNLITNGYGTDTAALSSTIFSDGYACGQCYQIRVPCNAIRKGGIKFSFQGNGYWLLVYVMNVAGAGDIKQMWVKGTKNGWISMSHNWGASYQAFATLKGQALSFRLTSYTTKQTITAYNVAPANWNLGLTYQGNVNSSIDLPVYNLQTPLSFIAIQSHGKVFD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G305520`
TK1151 ID	TkA07G305520
OH-1004 ID	LXL04_029344
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	86.200
Protein coverage (%)	TK1151 86.224 / OH-1004 85.965 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G305520

Location Chr07:76681663-76682639 (+)

Description Similar to EXPA7: Expansin-A7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12560`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At1g62980`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At2g37640`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0535900`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`UniProt: A2Y5R6`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029344 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006949 syncytium formation Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0048767 root hair elongation Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G12560

ath:AT1G62980

ath:AT2G39700

dosa:Os05g0477600

osa:107277540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.362

Rank 1 · TkA07G305520 · TK1151

Cytoplasm0.296

Rank 2 · TkA07G305520 · TK1151

Nucleus0.172

Rank 3 · TkA07G305520 · TK1151

Lysosome / Vacuole0.129

Rank 4 · TkA07G305520 · TK1151

Endoplasmic reticulum0.102

Rank 5 · TkA07G305520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22514EXPB1_D115-67 aa

PF29515Expansin_N23-69 aa

PF03330DPBB_145-67 aa

PF01357Expansin_C77-155 aa

PF03330DPBB_1143-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G305520	`PF22514`	EXPB1_D1	15	67	0.0013	19.8
TkA07G305520	`PF29515`	Expansin_N	23	69	4.5e-08	34.0
TkA07G305520	`PF03330`	DPBB_1	45	67	0.0018	19.2
TkA07G305520	`PF01357`	Expansin_C	77	155	3.6e-27	95.0
TkA07G305520	`PF03330`	DPBB_1	143	155	0.0018	19.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LN94`	Arabidopsis thaliana	sp\|Q9LN94\|EXPA7_ARATH Expansin-A7	49.400%	Swiss-Prot	Medium
`Q9LQ07`	Arabidopsis thaliana	sp\|Q9LQ07\|EXP18_ARATH Expansin-A18	47.400%	Swiss-Prot	Medium
`O80932`	Arabidopsis thaliana	sp\|O80932\|EXPA3_ARATH Expansin-A3	38.700%	Swiss-Prot	Medium
`Q8W2X8`	Oryza sativa subsp. japonica	sp\|Q8W2X8\|EXP30_ORYSJ Putative expansin-A30	50.400%	Swiss-Prot	High
`A2Y5R6`	Oryza sativa subsp. indica	sp\|A2Y5R6\|EXPA4_ORYSI Expansin-A4	38.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card