TkA07G304290 | RubberDandelionOmics

Gene overview

TkA07G304290

Reference: TK1151 Chr: Chr07 Coordinates: 76355291-76355915 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · TkA07G304290|TK1151|cDNA

ATGTCCTCTTTCAAGAGAGAGTTTGCGCACCTCAGAATTGCTCTAGAGTCCATACAGATTGCCACCAACAACTTTGCCGAATGCAATGTCCTTGGGGAAGGTGGATATGGTAAAGTTTACAAAGTGATGAAGAGAAGAAAAAAAATCCTTGTGTATGAGTATGCAGCAAACCAAAGCCTTGACTTTCATCTAGAGGACCGCACTTTCATGTGGATTCAACGTCTAAAGGTGTGTCTTGGGACTGCGCGTGGTTTGGAGTG...

CDS

Download CDS FASTA

480 bp · TkA07G304290|TK1151|CDS

ATGTCCTCTTTCAAGAGAGAGTTTGCGCACCTCAGAATTGCTCTAGAGTCCATACAGATTGCCACCAACAACTTTGCCGAATGCAATGTCCTTGGGGAAGGTGGATATGGTAAAGTTTACAAAGTGATGAAGAGAAGAAAAAAAATCCTTGTGTATGAGTATGCAGCAAACCAAAGCCTTGACTTTCATCTAGAGGACCGCACTTTCATGTGGATTCAACGTCTAAAGGTGTGTCTTGGGACTGCGCGTGGTTTGGAGTG...

Protein

Download Protein FASTA

159 aa · TkA07G304290|TK1151|PROTEIN

MSSFKREFAHLRIALESIQIATNNFAECNVLGEGGYGKVYKVMKRRKKILVYEYAANQSLDFHLEDRTFMWIQRLKVCLGTARGLECLHNPRGKQRVLHCDIKSANILLDENWKAKIAYFCFSKYGPASQNRSYLITQAKTTLGFVGLLKAKLYLFTRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G304290`
TK1151 ID	TkA07G304290
OH-1004 ID	LXL04_037425
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	43.300
Protein coverage (%)	TK1151 96.226 / OH-1004 15.975 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G304290

Location Chr07:76355291-76355915 (+)

Description Similar to CPK9: Calcium-dependent protein kinase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24400`	Proline-rich receptor-like protein kinase PERK2.	No verified direct reference in this release
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At5g54380`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	A receptor-like kinase mediates the response of Arabidopsis cells to the inhibition of cellulose synthesis.2007 · DOI: 10.1016/j.cub.2007.05.018 Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037425 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0009931 calcium-dependent protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G50700

ath:AT3G20410

dosa:Os07g0515100

osa:4343373

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.603

Rank 1 · TkA07G304290 · TK1151

Nucleus0.233

Rank 2 · TkA07G304290 · TK1151

Cell membrane0.140

Rank 3 · TkA07G304290 · TK1151

Endoplasmic reticulum0.095

Rank 4 · TkA07G304290 · TK1151

Mitochondrion0.068

Rank 5 · TkA07G304290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase28-48 aa

PF07714PK_Tyr_Ser-Thr29-44 aa

PF24237INO80E36-53 aa

PF07714PK_Tyr_Ser-Thr42-128 aa

PF03109ABC145-131 aa

PF00069Pkinase49-137 aa

PF01636APH90-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G304290	`PF00069`	Pkinase	28	48	5.3e-14	53.0
TkA07G304290	`PF07714`	PK_Tyr_Ser-Thr	29	44	2.5e-09	37.6
TkA07G304290	`PF24237`	INO80E	36	53	0.17	12.9
TkA07G304290	`PF07714`	PK_Tyr_Ser-Thr	42	128	2.5e-09	37.6
TkA07G304290	`PF03109`	ABC1	45	131	0.073	12.9
TkA07G304290	`PF00069`	Pkinase	49	137	5.3e-14	53.0
TkA07G304290	`PF01636`	APH	90	114	0.17	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK03`	Arabidopsis thaliana	sp\|Q9LK03\|PERK2_ARATH Proline-rich receptor-like protein kinase PERK2	31.100%	Swiss-Prot	Medium
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	31.500%	Swiss-Prot	Medium
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	41.300%	Swiss-Prot	Medium
`Q9SR05`	Arabidopsis thaliana	sp\|Q9SR05\|ANX1_ARATH Receptor-like protein kinase ANXUR1	32.600%	Swiss-Prot	Medium
`Q9LK35`	Arabidopsis thaliana	sp\|Q9LK35\|THE1_ARATH Receptor-like protein kinase THESEUS 1	44.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card