Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1206 bp · TkA07G303580|TK1151|cDNA
GGGACAACTAAAAATAGGAAGGTAGACAATAAAAATGGGACGGATGGAATATTATTTAAAGGTCCATGTGCGGTTCATGTTCCTAGGTATTGTAAATTTATTCAGGTCTTAATTAGCCTATAGTTAAAAAAAAAGGCACTACCACACGACACAATATATCAATATCGGAAGCAGTGAGATCGATCCATCCATATTCCTTACTCATTCATCCCACCGGCAACAATGATCAACAAAACCAGATTGGAGGGTAAAGTAGCCCT...
792 bp · TkA07G303580|TK1151|CDS
ATGATCAACAAAACCAGATTGGAGGGTAAAGTAGCCCTTATCACCGGCGGTGCTAGCGGCATCGGAGAACAGGCTGCAAGGTTGTTCCTGGAGAACGGAGCTCGAGTCGTGATTGTCGACGTTCAAGATGATTTGGGCCACCAAGTGGTTGCCTCCTGCATGAATCCCAACATCTGCTTTTATCACTGTGACGTCACCGACGAAAAACAGGTGGAGGAAGCCGTCAGCCACACCGTCGCCAAATACGGAAGCCTCGACGT...
Protein
Download Protein FASTA263 aa · TkA07G303580|TK1151|PROTEIN
MINKTRLEGKVALITGGASGIGEQAARLFLENGARVVIVDVQDDLGHQVVASCMNPNICFYHCDVTDEKQVEEAVSHTVAKYGSLDVLFSNAGIMGPISTLLDMDLDAFDNTMAVNVRGVAATIKHAARAMVAGKIRGSIICTASVAASIGGAGPHAYTTSKHAMVGLMKTACNELGGYGIRVNCVSPFGVGTPLSCTAYNLEAGQVEESCCERANLKGIVLKARHVAEAALFLASDESAYVSGQNLGVDGGFTVVSHSY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G303580 |
|---|---|
| TK1151 ID | TkA07G303580 |
| OH-1004 ID | LXL04_029330 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 99.200 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G303580 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:76213673-76214954 (+) | ||||||||||||||||||
| Description | Similar to SDR3b: Short-chain dehydrogenase reductase 3b | ||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||||||||
| GO annotations (OH1004 source) | GO:0009626 plant-type hypersensitive response Biological Process GO:0042742 defense response to bacterium Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0010494 cytoplasmic stress granule Cellular Component GO:0005507 copper ion binding Molecular Function GO:0016491 oxidoreductase activity Molecular Function | ||||||||||||||||||
| KEGG gene cross-reference | ath:AT2G47120 ath:AT2G47130 ath:AT2G47140 ath:AT3G29250 ath:AT3G29260 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01175Urocanase5-43 aaPF00106adh_short10-196 aaPF08659KR12-170 aaPF01370Epimerase12-77 aaPF16363GDP_Man_Dehyd13-78 aaPF010733Beta_HSD13-132 aaPF027373HCDH_N17-55 aaPF13561adh_short_C218-254 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G303580 | PF01175 | Urocanase | 5 | 43 | 1.8 | 8.9 |
| TkA07G303580 | PF00106 | adh_short | 10 | 196 | 4.9e-50 | 170.4 |
| TkA07G303580 | PF08659 | KR | 12 | 170 | 1e-12 | 49.1 |
| TkA07G303580 | PF01370 | Epimerase | 12 | 77 | 2e-05 | 24.8 |
| TkA07G303580 | PF16363 | GDP_Man_Dehyd | 13 | 78 | 0.00037 | 20.8 |
| TkA07G303580 | PF01073 | 3Beta_HSD | 13 | 132 | 0.0028 | 17.5 |
| TkA07G303580 | PF02737 | 3HCDH_N | 17 | 55 | 0.11 | 13.1 |
| TkA07G303580 | PF13561 | adh_short_C2 | 18 | 254 | 6e-63 | 213.3 |
| TkA07G303580 | PF29762 | OWP_N | 78 | 135 | 0.12 | 13.9 |
| TkA07G303580 | PF01175 | Urocanase | 117 | 166 | 1.8 | 8.9 |
| TkA07G303580 | PF02737 | 3HCDH_N | 203 | 240 | 0.11 | 13.1 |
| TkA07G303580 | PF08659 | KR | 213 | 237 | 1e-12 | 49.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q94K41 | Arabidopsis thaliana | sp|Q94K41|SDR3B_ARATH Short-chain dehydrogenase reductase 3b | 64.500% | Swiss-Prot | High |
F4J300 | Arabidopsis thaliana | sp|F4J300|SDR5_ARATH Short-chain dehydrogenase reductase 5 | 64.300% | Swiss-Prot | High |
F4J2Z7 | Arabidopsis thaliana | sp|F4J2Z7|SDR4_ARATH Short-chain dehydrogenase reductase 4 | 62.500% | Swiss-Prot | High |
O80713 | Arabidopsis thaliana | sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a | 62.900% | Swiss-Prot | High |
O80714 | Arabidopsis thaliana | sp|O80714|SDR3C_ARATH Short-chain dehydrogenase reductase 3c | 60.400% | Swiss-Prot | High |