LXL04_029330 | RubberDandelionOmics

Gene overview

LXL04_029330

Reference: OH-1004 Chr: Chr06 Coordinates: 87708902-87709769 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

792 bp · LXL04_029330|LXL04_029330|OH1004|cDNA

ATGATCAACAAAACCAGATTGGAGGGTAAAGTAGCCCTTATCACCGGCGGTGCTAGCGGCATCGGAGAACAGGCTGCAAGGTTGTTCCTGGAGAACGGAGCTCGAGTCGTGATTGTCGACGTTCAAGATGATTTGGGCCACCAAGTGGTTGCCTCCTGCATGAATCCCAACATCTGCTTTTATCACTGTGACGTCACCGACGAAAAACAGGTGGAGGAAGCCGTCAGCCACACCGTCGCCAAATACGGAAGCCTCGACGT...

CDS

Download CDS FASTA

792 bp · LXL04_029330|LXL04_029330|OH1004|CDS

ATGATCAACAAAACCAGATTGGAGGGTAAAGTAGCCCTTATCACCGGCGGTGCTAGCGGCATCGGAGAACAGGCTGCAAGGTTGTTCCTGGAGAACGGAGCTCGAGTCGTGATTGTCGACGTTCAAGATGATTTGGGCCACCAAGTGGTTGCCTCCTGCATGAATCCCAACATCTGCTTTTATCACTGTGACGTCACCGACGAAAAACAGGTGGAGGAAGCCGTCAGCCACACCGTCGCCAAATACGGAAGCCTCGACGT...

Protein

Download Protein FASTA

263 aa · LXL04_029330|LXL04_029330|OH1004|PROTEIN

MINKTRLEGKVALITGGASGIGEQAARLFLENGARVVIVDVQDDLGHQVVASCMNPNICFYHCDVTDEKQVEEAVSHTVAKYGSLDVLFSNAGIMGPISTLLDMDLHAFDNTMAVNVRGVAATIKHAARAMVAGKIRGSIICTASVAASIGGAGPHAYTTSKHAMVGLMKTACNELGGYGIRVNCVSPFGVGTPLSCTAYNLEAGQVEESCCQRANLKGIVLKARHVAEAALFLASDESAYVSGQNLGVDGGFTVVSHSY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029330`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029330

Location Chr06:87708902-87709769 (+)

Description Similar to SDR3b: Short-chain dehydrogenase reductase 3b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47140`	Short-chain dehydrogenase reductase 3b.	No verified direct reference in this release
`At3g29260`	Short-chain dehydrogenase reductase 5.	No verified direct reference in this release
`At3g29250`	Short-chain dehydrogenase reductase 4.	No verified direct reference in this release
`At2g47130`	Confers resistance to the incompatible pathogenic bacteria P.syringae pv. tomato DC3000 in a PR1-dependent manner.	No verified direct reference in this release
`At2g47120`	Short-chain dehydrogenase reductase 3c.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029330 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT2G47120

ath:AT2G47130

ath:AT2G47140

ath:AT3G29250

ath:AT3G29260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.576

Rank 1 · LXL04_029330 · OH-1004

Nucleus0.204

Rank 2 · LXL04_029330 · OH-1004

Peroxisome0.163

Rank 3 · LXL04_029330 · OH-1004

Mitochondrion0.160

Rank 4 · LXL04_029330 · OH-1004

Plastid0.043

Rank 5 · LXL04_029330 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short10-196 aa

PF08659.17KR12-170 aa

PF13561.13adh_short_C218-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029330	`PF00106.32`	adh_short	10	196	8.5e-50	169.7
LXL04_029330	`PF08659.17`	KR	12	170	4.5e-12	47.0
LXL04_029330	`PF13561.13`	adh_short_C2	18	254	1.7e-62	211.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94K41`	Arabidopsis thaliana	Short-chain dehydrogenase reductase 3b	64.542%	Swiss-Prot	strong database homology
`F4J300`	Arabidopsis thaliana	Short-chain dehydrogenase reductase 5	64.286%	Swiss-Prot	strong database homology
`F4J2Z7`	Arabidopsis thaliana	Short-chain dehydrogenase reductase 4	62.550%	Swiss-Prot	strong database homology
`O80713`	Arabidopsis thaliana	Short-chain dehydrogenase reductase 3a	62.948%	Swiss-Prot	strong database homology
`O80714`	Arabidopsis thaliana	Short-chain dehydrogenase reductase 3c	60.392%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card