TkA07G296330 | RubberDandelionOmics

Gene overview

TkA07G296330

Reference: TK1151 Chr: Chr07 Coordinates: 74352305-74355128 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

726 bp · TkA07G296330|TK1151|cDNA

ATGCTATTGAAGAAATGGGCAGTTTATTTAGACAACAAAGCACAAGCAAGATCATTAGCTAAAGAACAAGGCGATGAGCATCAGAAGAACATTGGTTTATGTTCATTATCTACTACCAAGAGTATTCGAACTTTTGCACTTGAGGAAATCAAAGCAACAACTAGGGATTTTCGAATAAGGATAGGTGTTGGAGCCACATCGTATGTTTATCTAGCTGACCTTGGTGATGGGCGGTTTGGTGCGGTGAAGAGGGTGATGGA...

CDS

Download CDS FASTA

726 bp · TkA07G296330|TK1151|CDS

ATGCTATTGAAGAAATGGGCAGTTTATTTAGACAACAAAGCACAAGCAAGATCATTAGCTAAAGAACAAGGCGATGAGCATCAGAAGAACATTGGTTTATGTTCATTATCTACTACCAAGAGTATTCGAACTTTTGCACTTGAGGAAATCAAAGCAACAACTAGGGATTTTCGAATAAGGATAGGTGTTGGAGCCACATCGTATGTTTATCTAGCTGACCTTGGTGATGGGCGGTTTGGTGCGGTGAAGAGGGTGATGGA...

Protein

Download Protein FASTA

241 aa · TkA07G296330|TK1151|PROTEIN

MLLKKWAVYLDNKAQARSLAKEQGDEHQKNIGLCSLSTTKSIRTFALEEIKATTRDFRIRIGVGATSYVYLADLGDGRFGAVKRVMEERGGSQKMFLDEVSILLRISHPNLVGLLGFCLDQGEQLLLLEYIPNKSLFDRLHTRKGKSSGTLSWSSRVSIALDIAYALDYLHSVADPPDVDIMMGMLDPKLNGEVNVEQLKVLVNVANMALLENSMARPNMAEIAYKMSSCIETLPENDLPV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G296330`
TK1151 ID	TkA07G296330
OH-1004 ID	LXL04_029280
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	70.600
Protein coverage (%)	TK1151 100.000 / OH-1004 98.266 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G296330

Location Chr07:74352305-74355128 (-)

Description Similar to CRCK2: Calmodulin-binding receptor-like cytoplasmic kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23450`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g06840`	Probable LRR receptor-like serine/threonine-protein kinase At1g06840.	No verified direct reference in this release
`At4g22130`	Protein STRUBBELIG-RECEPTOR FAMILY 8.	No verified direct reference in this release
`At1g53730`	Protein STRUBBELIG-RECEPTOR FAMILY 6.	No verified direct reference in this release
`At5g37450`	Probable LRR receptor-like serine/threonine-protein kinase At5g37450.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029280 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010310 regulation of hydrogen peroxide metabolic process Biological Process

GO:0043410 positive regulation of MAPK cascade Biological Process

GO:0045087 innate immune response Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G49730

ath:AT2G30740

ath:AT4G00330

ath:AT5G18610

dosa:Os04g0540900

osa:4336539

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.669

Rank 1 · TkA07G296330 · TK1151

Cytoplasm0.233

Rank 2 · TkA07G296330 · TK1151

Nucleus0.228

Rank 3 · TkA07G296330 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkA07G296330 · TK1151

Golgi apparatus0.031

Rank 5 · TkA07G296330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase60-172 aa

PF07714PK_Tyr_Ser-Thr60-172 aa

PF07714PK_Tyr_Ser-Thr213-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G296330	`PF00069`	Pkinase	60	172	3.1e-14	53.7
TkA07G296330	`PF07714`	PK_Tyr_Ser-Thr	60	172	3.6e-14	53.4
TkA07G296330	`PF07714`	PK_Tyr_Ser-Thr	213	232	3.6e-14	53.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY67`	Arabidopsis thaliana	sp\|Q8RY67\|WAKLO_ARATH Wall-associated receptor kinase-like 14	33.900%	Swiss-Prot	Medium
`C0LGD7`	Arabidopsis thaliana	sp\|C0LGD7\|Y1684_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g06840	34.900%	Swiss-Prot	Medium
`Q6R2J8`	Arabidopsis thaliana	sp\|Q6R2J8\|SRF8_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 8	32.600%	Swiss-Prot	Medium
`Q9C8M9`	Arabidopsis thaliana	sp\|Q9C8M9\|SRF6_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 6	33.100%	Swiss-Prot	Medium
`C0LGU1`	Arabidopsis thaliana	sp\|C0LGU1\|Y5374_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g37450	38.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card