LXL04_029280 | RubberDandelionOmics

Gene overview

LXL04_029280

Reference: OH-1004 Chr: Chr06 Coordinates: 86018427-86021297 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1067 bp · LXL04_029280|LXL04_029280|OH1004|cDNA

GGTATTGGATAGGTGGGGCAATTGTATTGATCATCATTCTCACCATGCTATTGAAGAAATGGGCAGTTTATTTAGACAACAAAGCACAAGCAAGATCATTAGCTAAAGAACAAGGCGATGAGCATCAGAAGAACATTGGTTTATGTTCATTATCTACTACCAAGAGTATTCGAACTTTTGCACTTGAGGAAATCAAAGCAACAACTAGGGATTTTCGAATAAGGATAGGTGTTGGAGCCACATCGTATGTTTATCTAGCT...

CDS

Download CDS FASTA

1041 bp · LXL04_029280|LXL04_029280|OH1004|CDS

TTGATCATCATTCTCACCATGCTATTGAAGAAATGGGCAGTTTATTTAGACAACAAAGCACAAGCAAGATCATTAGCTAAAGAACAAGGCGATGAGCATCAGAAGAACATTGGTTTATGTTCATTATCTACTACCAAGAGTATTCGAACTTTTGCACTTGAGGAAATCAAAGCAACAACTAGGGATTTTCGAATAAGGATAGGTGTTGGAGCCACATCGTATGTTTATCTAGCTGACCTTGGTGATGGGCGGTTTGGTGC...

Protein

Download Protein FASTA

346 aa · LXL04_029280|LXL04_029280|OH1004|PROTEIN

MIIILTMLLKKWAVYLDNKAQARSLAKEQGDEHQKNIGLCSLSTTKSIRTFALEEIKATTRDFRIRIGVGATSYVYLADLGDGRFGAVKRVMEERGGSQKMFLDEVSILLRISHPNLVGLLGFCLDQGEQLLLLEYIPNKSLFDRLHTRKGKSSGTLSWSSRVSIALDIAYALDYLHSVADPPVIHRDVKSSNILLINDDHAKLADFGLCKLGHDTQSAQTPTIIRGSLGYVDTNYLNTGLLSPKSDVYSFGVLLLELIT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029280`
TK1151 ID	TkA07G296330
OH-1004 ID	LXL04_029280
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	70.600
Protein coverage (%)	TK1151 100.000 / OH-1004 98.266 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029280

Location Chr06:86018427-86021297 (-)

Description Similar to CRCK2: Calmodulin-binding receptor-like cytoplasmic kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49730`	Probable receptor-like protein kinase At1g49730.	No verified direct reference in this release
`At4g00330`	Calmodulin-binding receptor-like cytoplasmic kinase 2.	No verified direct reference in this release
`At5g18610`	May act as a receptor-like cytoplasmic kinase in chitin-induced immune signaling.	Selective regulation of the chitin-induced defense response by the Arabidopsis receptor-like cytoplasmic kinase PBL27.2014 · DOI: 10.1111/tpj.12535 The Arabidopsis CERK1-associated kinase PBL27 connects chitin perception to MAPK activation.2016 · DOI: 10.15252/embj.201694248
`At2g30740`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0540900`	Acts probably as a dual specificity protein kinase (Probable).	The Receptor-Like Cytoplasmic Kinase STRK1 Phosphorylates and Activates CatC, Thereby Regulating H2O2 Homeostasis and Improving Salt Tolerance in Rice.2018 · DOI: 10.1105/tpc.17.01000 The zinc finger protein DHHC09 S-acylates the kinase STRK1 to regulate H2O2 homeostasis and promote salt tolerance in rice.2024 · DOI: 10.1093/plcell/koae001

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029280 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010310 regulation of hydrogen peroxide metabolic process Biological Process

GO:0043410 positive regulation of MAPK cascade Biological Process

GO:0045087 innate immune response Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G49730

ath:AT2G30740

ath:AT4G00330

ath:AT5G18610

dosa:Os04g0540900

osa:4336539

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.704

Rank 1 · LXL04_029280 · OH-1004

Cytoplasm0.207

Rank 2 · LXL04_029280 · OH-1004

Nucleus0.175

Rank 3 · LXL04_029280 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_029280 · OH-1004

Golgi apparatus0.031

Rank 5 · LXL04_029280 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase66-286 aa

PF07714.24PK_Tyr_Ser-Thr66-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029280	`PF00069.32`	Pkinase	66	286	1.3e-37	130.4
LXL04_029280	`PF07714.24`	PK_Tyr_Ser-Thr	66	282	2.2e-35	123.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX99`	Arabidopsis thaliana	Probable receptor-like protein kinase At1g49730	34.808%	Swiss-Prot	moderate database homology
`Q8VZJ9`	Arabidopsis thaliana	Calmodulin-binding receptor-like cytoplasmic kinase 2	38.908%	Swiss-Prot	moderate database homology
`Q1PDV6`	Arabidopsis thaliana	Serine/threonine-protein kinase PBL27	40.064%	Swiss-Prot	moderate database homology
`O49339`	Arabidopsis thaliana	Protein CYTOSOLIC ABA RECEPTOR KINASE 8	38.144%	Swiss-Prot	moderate database homology
`Q7XR88`	Oryza sativa subsp. japonica	Salt tolerance receptor-like cytoplasmic kinase 1	37.333%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card