TkA07G292150 | RubberDandelionOmics

Gene overview

TkA07G292150

Reference: TK1151 Chr: Chr07 Coordinates: 73268320-73278954 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4231 bp · TkA07G292150|TK1151|cDNA

AACGACGTCGGGTTGTTTCCTTCACTATCTTCTCTCCTACGCTTTCCTTTTCCCTCTGCCTTCCGGTCACAAACATAGCTTCTTCTTTTGCTGGTTTCCTCGCGCGACATGTTCTTCGACGGGACTCTACCGCACCAATGATTAGCATGATGACCACCATCGTGGGTTTGCGGTCTTTCAGTTCACAATCTAAGGGTTCTTAAAAATAATCAATGCCTCTATCATCTTCTTCAACTTCTAAAGAATAACTGTGGAGGACT...

CDS

Download CDS FASTA

3093 bp · TkA07G292150|TK1151|CDS

ATGAGTTCTTCCGAAATATCCTCACAATTCCATGCAGGAGTGGTTCCTCAAATTCTCGGCTTTCTTTTCTTCTTCTTTTTTAATGGAGCTTCAGGGACTACTTTTACTTTCATAAATTACTGTGAGTTCACAATTTGGCCTGGAATCTTAGGCACGCCTGATTTCAATCTCACCGGATTCGAGCTAACAAAGGGTAATTCACACTCTTTTCAAACCCCAGATGTCTGGAGAGGTACTTTCTGGGGTAGGACAGGTTGCAA...

Protein

Download Protein FASTA

1030 aa · TkA07G292150|TK1151|PROTEIN

MSSSEISSQFHAGVVPQILGFLFFFFFNGASGTTFTFINYCEFTIWPGILGTPDFNLTGFELTKGNSHSFQTPDVWRGTFWGRTGCNFNGSGNMSCTTGDCGTGKMDCNGNTYTKPVTIVEFAVKQFQGLDFYDVSLVDGFNLPILVKATGGSGSGLRSCAKTGCADDLNQRCPPELTLTGGGACRSACQTFGSPEYCCNSSFSTPSACKPTAYAQLFKSACPRSYSTQFDVETSIFTCSDADYVVRFCPAPDSFSAIKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G292150`
TK1151 ID	TkA07G292150
OH-1004 ID	LXL04_029253
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 94.322 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G292150

Location Chr07:73268320-73278954 (-)

Description Similar to CES101: G-type lectin S-receptor-like serine/threonine-protein kinase CES101

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16030`	Promotes the expression of genes involved in photosynthesis at least in dedifferentiated calli.	Arabidopsis mutants by activation tagging in which photosynthesis genes are expressed in dedifferentiated calli.2006 · DOI: 10.1093/pcp/pci242
`At1g67520`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520.	No verified direct reference in this release
`At4g21390`	G-type lectin S-receptor-like serine/threonine-protein kinase B120.	No verified direct reference in this release
`At1g11410`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g11410.	No verified direct reference in this release
`At4g21380`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029253 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009620 response to fungus Biological Process

GO:0045087 innate immune response Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G11300

ath:AT1G11330

ath:AT1G67520

ath:AT3G16030

ath:AT4G21390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.849

Rank 1 · TkA07G292150 · TK1151

Endoplasmic reticulum0.077

Rank 2 · TkA07G292150 · TK1151

Cytoplasm0.073

Rank 3 · TkA07G292150 · TK1151

Nucleus0.040

Rank 4 · TkA07G292150 · TK1151

Lysosome / Vacuole0.031

Rank 5 · TkA07G292150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00314Thaumatin39-250 aa

PF01453B_lectin302-405 aa

PF08276PAN_2534-591 aa

PF07714PK_Tyr_Ser-Thr710-915 aa

PF00069Pkinase710-910 aa

PF03109ABC1718-738 aa

PF03109ABC1776-872 aa

PF01636APH819-857 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G292150	`PF00314`	Thaumatin	39	250	2.1e-69	234.1
TkA07G292150	`PF01453`	B_lectin	302	405	3.9e-24	85.8
TkA07G292150	`PF08276`	PAN_2	534	591	3.5e-06	27.8
TkA07G292150	`PF07714`	PK_Tyr_Ser-Thr	710	915	3e-48	165.1
TkA07G292150	`PF00069`	Pkinase	710	910	9.6e-44	150.5
TkA07G292150	`PF03109`	ABC1	718	738	1.3e-05	25.2
TkA07G292150	`PF03109`	ABC1	776	872	1.3e-05	25.2
TkA07G292150	`PF01636`	APH	819	857	0.17	12.3
TkA07G292150	`PF12330`	Haspin_kinase	831	864	0.087	12.5
TkA07G292150	`PF11883`	DUF3403	983	1030	1e-05	26.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW83`	Arabidopsis thaliana	sp\|Q9LW83\|CE101_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase CES101	40.400%	Swiss-Prot	Medium
`O64793`	Arabidopsis thaliana	sp\|O64793\|Y1675_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520	41.400%	Swiss-Prot	Medium
`O81906`	Arabidopsis thaliana	sp\|O81906\|B120_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase B120	39.100%	Swiss-Prot	Medium
`Q9LPZ3`	Arabidopsis thaliana	sp\|Q9LPZ3\|Y1141_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11410	38.700%	Swiss-Prot	Medium
`O81905`	Arabidopsis thaliana	sp\|O81905\|SD18_ARATH Receptor-like serine/threonine-protein kinase SD1-8	39.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card