TkA07G291480 | RubberDandelionOmics

Gene overview

TkA07G291480

Reference: TK1151 Chr: Chr07 Coordinates: 73112817-73113272 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

456 bp · TkA07G291480|TK1151|cDNA

ATGGATGGGGTGGATACGATCAGTGATTTGCCCGATCATATTCTTCACTTAATTCTTTCGCGTCTTCCAAGTACCGAAGAAGTTCATCGAACCAACATTTTGTCGAAACGATGGAGGTATCTGTGGACTTCAATCCCCTCTATAGACACCGATTATGCCCGACAAAAGTACCGAAAGGGTAAATGGGACATGTTTGAAGAGTTTGTGTATTGGGTTTTAGCAACCAAATCATCCGATTTGGATAGTTTTCGGTTATGTTA...

CDS

Download CDS FASTA

456 bp · TkA07G291480|TK1151|CDS

ATGGATGGGGTGGATACGATCAGTGATTTGCCCGATCATATTCTTCACTTAATTCTTTCGCGTCTTCCAAGTACCGAAGAAGTTCATCGAACCAACATTTTGTCGAAACGATGGAGGTATCTGTGGACTTCAATCCCCTCTATAGACACCGATTATGCCCGACAAAAGTACCGAAAGGGTAAATGGGACATGTTTGAAGAGTTTGTGTATTGGGTTTTAGCAACCAAATCATCCGATTTGGATAGTTTTCGGTTATGTTA...

Protein

Download Protein FASTA

151 aa · TkA07G291480|TK1151|PROTEIN

MDGVDTISDLPDHILHLILSRLPSTEEVHRTNILSKRWRYLWTSIPSIDTDYARQKYRKGKWDMFEEFVYWVLATKSSDLDSFRLCYPGYYHVSRVEHWIRIAVMRRVKVVDLMICHRVWCEKLSIRLMFPVSGVSPFDHSRGIYLFLLIP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G291480`
TK1151 ID	TkA07G291480
OH-1004 ID	LXL04_029249
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.040 / OH-1004 62.009 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G291480

Location Chr07:73112817-73113272 (-)

Description Similar to At3g59200: F-box/LRR-repeat protein At3g59200

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02920`	F-box/LRR-repeat protein 25.	No verified direct reference in this release
`At5g56440`	Putative FBD-associated F-box protein At5g56440.	No verified direct reference in this release
`At1g16940`	Putative F-box/FBD/LRR-repeat protein At1g16940.	No verified direct reference in this release
`At3g49020`	FBD-associated F-box protein At3g49020.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029249 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G04230

ath:AT3G59200

ath:AT4G26350

ath:AT5G02920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.581

Rank 1 · TkA07G291480 · TK1151

Cytoplasm0.458

Rank 2 · TkA07G291480 · TK1151

Endoplasmic reticulum0.070

Rank 3 · TkA07G291480 · TK1151

Cell membrane0.057

Rank 4 · TkA07G291480 · TK1151

Mitochondrion0.036

Rank 5 · TkA07G291480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box7-46 aa

PF12937F-box-like7-41 aa

PF14699hGDE_N39-63 aa

PF00646F-box104-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G291480	`PF00646`	F-box	7	46	1.6e-06	28.5
TkA07G291480	`PF12937`	F-box-like	7	41	3.7e-05	24.1
TkA07G291480	`PF14699`	hGDE_N	39	63	0.14	13.0
TkA07G291480	`PF00646`	F-box	104	118	1.6e-06	28.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PE04`	Arabidopsis thaliana	sp\|Q1PE04\|FBL25_ARATH F-box/LRR-repeat protein 25	33.300%	Swiss-Prot	Medium
`Q9FM87`	Arabidopsis thaliana	sp\|Q9FM87\|FBD26_ARATH Putative FBD-associated F-box protein At5g56440	38.600%	Swiss-Prot	Medium
`Q9FZ53`	Arabidopsis thaliana	sp\|Q9FZ53\|FDL4_ARATH Putative F-box/FBD/LRR-repeat protein At1g16940	36.600%	Swiss-Prot	Medium
`Q9SMT9`	Arabidopsis thaliana	sp\|Q9SMT9\|FBD9_ARATH FBD-associated F-box protein At3g49020	51.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card