TkA07G291270 | RubberDandelionOmics

Gene overview

TkA07G291270

Reference: TK1151 Chr: Chr07 Coordinates: 73075590-73078446 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1404 bp · TkA07G291270|TK1151|cDNA

ATGTATCCCTTCGAAATATGTATGAAGGATGTTAAAGGACTTGTGCGAAACGGATACCGACCGGAGGGATGCATTGCTGAGGAGACTATTTCACAAGAAACAATAGAGTTTTTGGCGGATTATAAAAATTCCATGATATCTAATGGTATCCCACATGATAAACATGAAATGGATGAAAATGAAGACGTGGAGTCACTATTGGCAGGCAAACCAAGATATGATATGGATTATGTGAATCCTAGATGTTGGACTAAATCCGA...

CDS

Download CDS FASTA

1404 bp · TkA07G291270|TK1151|CDS

ATGTATCCCTTCGAAATATGTATGAAGGATGTTAAAGGACTTGTGCGAAACGGATACCGACCGGAGGGATGCATTGCTGAGGAGACTATTTCACAAGAAACAATAGAGTTTTTGGCGGATTATAAAAATTCCATGATATCTAATGGTATCCCACATGATAAACATGAAATGGATGAAAATGAAGACGTGGAGTCACTATTGGCAGGCAAACCAAGATATGATATGGATTATGTGAATCCTAGATGTTGGACTAAATCCGA...

Protein

Download Protein FASTA

467 aa · TkA07G291270|TK1151|PROTEIN

MYPFEICMKDVKGLVRNGYRPEGCIAEETISQETIEFLADYKNSMISNGIPHDKHEMDENEDVESLLAGKPRYDMDYVNPRCWTKSESTTLSHVGSSSSSAAPKLANSNKETSLSKVRCFKFQGFGHFQNACPDKRIVTVWEALGCREQSVEEQKMFNDVFVFEEDHEPEEQERYETPVHDTTLALRTLQTQVVHVDSAQRDQLFHKTPVYETTLALRIEMMSKLGLVTTAHPKSYALNWLDDDKSVKVSKQVKVCLKMG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G291270`
TK1151 ID	TkA07G291270
OH-1004 ID	LXL04_036541
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	35.600
Protein coverage (%)	TK1151 31.049 / OH-1004 17.476 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G291270`
Location	Chr07:73075590-73078446 (+)
Description	Similar to CYP704C1: Cytochrome P450 704C1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036541` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006631 fatty acid metabolic process Biological Process GO:0008610 lipid biosynthetic process Biological Process GO:0010214 seed coat development Biological Process GO:0010345 suberin biosynthetic process Biological Process GO:0010584 pollen exine formation Biological Process GO:0035336 long-chain fatty-acyl-CoA metabolic process Biological Process GO:0042761 very long-chain fatty acid biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0080110 sporopollenin biosynthetic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component
KEGG gene cross-reference	ag:AAZ39642 ath:AT1G69500 ath:AT2G45970 ath:AT5G23190 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.534

Rank 1 · TkA07G291270 · TK1151

Nucleus0.489

Rank 2 · TkA07G291270 · TK1151

Mitochondrion0.044

Rank 3 · TkA07G291270 · TK1151

Endoplasmic reticulum0.039

Rank 4 · TkA07G291270 · TK1151

Cell membrane0.033

Rank 5 · TkA07G291270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13960DUF42181-43 aa

PF03871RNA_pol_Rpb5_N25-45 aa

PF03871RNA_pol_Rpb5_N139-172 aa

PF30863PRO_PEG10-RTL1220-284 aa

PF03871RNA_pol_Rpb5_N282-337 aa

PF30863PRO_PEG10-RTL1293-327 aa

PF17921Integrase_H2C2438-466 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G291270	`PF13960`	DUF4218	1	43	3.4e-06	27.6
TkA07G291270	`PF03871`	RNA_pol_Rpb5_N	25	45	0.067	14.5
TkA07G291270	`PF03871`	RNA_pol_Rpb5_N	139	172	0.067	14.5
TkA07G291270	`PF30863`	PRO_PEG10-RTL1	220	284	0.0048	18.0
TkA07G291270	`PF03871`	RNA_pol_Rpb5_N	282	337	0.067	14.5
TkA07G291270	`PF30863`	PRO_PEG10-RTL1	293	327	0.0048	18.0
TkA07G291270	`PF17921`	Integrase_H2C2	438	466	0.064	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card