TkA07G286160 | RubberDandelionOmics

Gene overview

TkA07G286160

Reference: TK1151 Chr: Chr07 Coordinates: 71821983-71825669 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · TkA07G286160|TK1151|cDNA

CTCACAGCTGCCACTGATGATTTCTCGGCAAAAAATAAGCTCGGTCAGGGTGGTTTTGGCCCTGTTTACAAGGGAAAACTAGGGGATGGACAAGAAATTGCAATCAAAAGACTTTCAAGAACGTCAAGGCAAGGACTTGTGGAATTCAAGAATGAACTTATACTCATAGCTAAACTCCAACACACAAATCTTGTTCGAGTTCTCGGTTGTTGTATTCACGGGGTAGAAAAGATATTAATATATGAATATATGCCCAACAA...

CDS

Download CDS FASTA

981 bp · TkA07G286160|TK1151|CDS

CTCACAGCTGCCACTGATGATTTCTCGGCAAAAAATAAGCTCGGTCAGGGTGGTTTTGGCCCTGTTTACAAGGGAAAACTAGGGGATGGACAAGAAATTGCAATCAAAAGACTTTCAAGAACGTCAAGGCAAGGACTTGTGGAATTCAAGAATGAACTTATACTCATAGCTAAACTCCAACACACAAATCTTGTTCGAGTTCTCGGTTGTTGTATTCACGGGGTAGAAAAGATATTAATATATGAATATATGCCCAACAA...

Protein

Download Protein FASTA

326 aa · TkA07G286160|TK1151|PROTEIN

LTAATDDFSAKNKLGQGGFGPVYKGKLGDGQEIAIKRLSRTSRQGLVEFKNELILIAKLQHTNLVRVLGCCIHGVEKILIYEYMPNKSLDFFLFDENRKAELDWPKRFIIIEGIAQGLLYLHKYSRMKVIHRDLKANNILLDEKMNPKISDFGMTRISEQNETEAMTMRVVGTYGYMSPEYALRGIFSIKSDVFSFGVMILEIISGRRNSSFVHLEETFSLIGYAWELWQQGDTLELKDPTLGNTCDVRQFIRTVHVALL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G286160`
TK1151 ID	TkA07G286160
OH-1004 ID	LXL04_029217
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	81.300
Protein coverage (%)	TK1151 99.080 / OH-1004 17.276 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G286160

Location Chr07:71821983-71825669 (-)

Description Similar to CES101: G-type lectin S-receptor-like serine/threonine-protein kinase CES101

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11330`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330.	No verified direct reference in this release
`At4g21390`	G-type lectin S-receptor-like serine/threonine-protein kinase B120.	No verified direct reference in this release
`At1g67520`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520.	No verified direct reference in this release
`At1g61610`	Putative G-type lectin S-receptor-like serine/threonine-protein kinase At1g61610.	No verified direct reference in this release
`At4g23180`	Cysteine-rich receptor-like protein kinase 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029217 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009620 response to fungus Biological Process

GO:0045087 innate immune response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G67520

ath:AT3G16030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.590

Rank 1 · TkA07G286160 · TK1151

Cytoplasm0.356

Rank 2 · TkA07G286160 · TK1151

Nucleus0.203

Rank 3 · TkA07G286160 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA07G286160 · TK1151

Golgi apparatus0.035

Rank 5 · TkA07G286160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase9-221 aa

PF07714PK_Tyr_Ser-Thr10-226 aa

PF03109ABC114-38 aa

PF01163RIO122-39 aa

PF03109ABC176-167 aa

PF01163RIO1122-155 aa

PF12330Haspin_kinase130-162 aa

PF11883DUF3403282-326 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G286160	`PF00069`	Pkinase	9	221	1.4e-41	143.4
TkA07G286160	`PF07714`	PK_Tyr_Ser-Thr	10	226	3.5e-47	161.6
TkA07G286160	`PF03109`	ABC1	14	38	2.7e-05	24.2
TkA07G286160	`PF01163`	RIO1	22	39	0.14	12.5
TkA07G286160	`PF03109`	ABC1	76	167	2.7e-05	24.2
TkA07G286160	`PF01163`	RIO1	122	155	0.14	12.5
TkA07G286160	`PF12330`	Haspin_kinase	130	162	0.02	14.6
TkA07G286160	`PF11883`	DUF3403	282	326	8e-06	26.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXB8`	Arabidopsis thaliana	sp\|Q9SXB8\|Y1133_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330	58.000%	Swiss-Prot	High
`O81906`	Arabidopsis thaliana	sp\|O81906\|B120_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase B120	62.600%	Swiss-Prot	High
`O64793`	Arabidopsis thaliana	sp\|O64793\|Y1675_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520	64.700%	Swiss-Prot	High
`Q9SY89`	Arabidopsis thaliana	sp\|Q9SY89\|Y1661_ARATH Putative G-type lectin S-receptor-like serine/threonine-protein kinase At1g61610	61.200%	Swiss-Prot	High
`Q8GYA4`	Arabidopsis thaliana	sp\|Q8GYA4\|CRK10_ARATH Cysteine-rich receptor-like protein kinase 10	58.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card