LXL04_029217 | RubberDandelionOmics

Gene overview

LXL04_029217

Reference: OH-1004 Chr: Chr06 Coordinates: 83912193-83923806 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5699 bp · LXL04_029217|LXL04_029217|OH1004|cDNA

ATGACTTCTTCCTCGTTGTCATCATCATCTTCACAGTTCCATGCAGGAGTGGTTCCTCAAATTCTGGgctttcttttcttcttgttttctAATGGAGCTTCAGGGACTACCTTTACTTTCATAAATGACTGTGAGTTCACAATTTGGCCAGGAATCTCAGGCACGCCTGATCTCAACCTCACCGGATTCGAGCTAAGAAAGGGTAATTCACGCTCTTTTCAAGCCCCAGATGTCTGGAGAGGTACTTTCTGGGGTAGGAC...

CDS

Download CDS FASTA

5664 bp · LXL04_029217|LXL04_029217|OH1004|CDS

ATGACTTCTTCCTCGTTGTCATCATCATCTTCACAGTTCCATGCAGGAGTGGTTCCTCAAATTCTGGGCTTTCTTTTCTTCTTGTTTTCTAATGGAGCTTCAGGGACTACCTTTACTTTCATAAATGACTGTGAGTTCACAATTTGGCCAGGAATCTCAGGCACGCCTGATCTCAACCTCACCGGATTCGAGCTAAGAAAGGGTAATTCACGCTCTTTTCAAGCCCCAGATGTCTGGAGAGGTACTTTCTGGGGTAGGAC...

Protein

Download Protein FASTA

1887 aa · LXL04_029217|LXL04_029217|OH1004|PROTEIN

MTSSSLSSSSSQFHAGVVPQILGFLFFLFSNGASGTTFTFINDCEFTIWPGISGTPDLNLTGFELRKGNSRSFQAPDVWRGTFWGRTGCNFNGSGNGSCTTGDCGTGKMDCNGNTYTKPVTIVEFAVNQFQGLDFYDVSLVNGFNLPILVKATGGSGSGLRSCAKTGCVDDLNQRCPPELTLTGGGACRSACQTFGSPEYCCNSSFSTPSACKPTAYAQLFKSACPRSYSTQFDDETSTFTCSDADYVVRFCPAADSFSA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029217`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029217

Location Chr06:83912193-83923806 (-)

Description Similar to CES101: G-type lectin S-receptor-like serine/threonine-protein kinase CES101

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16030`	Promotes the expression of genes involved in photosynthesis at least in dedifferentiated calli.	Arabidopsis mutants by activation tagging in which photosynthesis genes are expressed in dedifferentiated calli.2006 · DOI: 10.1093/pcp/pci242
`At1g67520`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520.	No verified direct reference in this release
`At4g21390`	G-type lectin S-receptor-like serine/threonine-protein kinase B120.	No verified direct reference in this release
`At4g21380`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At1g65790`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029217 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009620 response to fungus Biological Process

GO:0045087 innate immune response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G67520

ath:AT3G16030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.798

Rank 1 · LXL04_029217 · OH-1004

Endoplasmic reticulum0.084

Rank 2 · LXL04_029217 · OH-1004

Cytoplasm0.083

Rank 3 · LXL04_029217 · OH-1004

Extracellular0.053

Rank 4 · LXL04_029217 · OH-1004

Nucleus0.043

Rank 5 · LXL04_029217 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00314.23Thaumatin42-253 aa

PF01453.31B_lectin305-408 aa

PF08276.18PAN_2546-594 aa

PF00069.32Pkinase713-916 aa

PF07714.24PK_Tyr_Ser-Thr715-914 aa

PF00314.23Thaumatin1062-1249 aa

PF01453.31B_lectin1274-1379 aa

PF08276.18PAN_21504-1566 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029217	`PF00314.23`	Thaumatin	42	253	2.6e-110	367.7
LXL04_029217	`PF01453.31`	B_lectin	305	408	1.5e-49	167.5
LXL04_029217	`PF08276.18`	PAN_2	546	594	3.8e-12	46.8
LXL04_029217	`PF00069.32`	Pkinase	713	916	1.5e-70	238.4
LXL04_029217	`PF07714.24`	PK_Tyr_Ser-Thr	715	914	6.4e-75	252.5
LXL04_029217	`PF00314.23`	Thaumatin	1062	1249	2.6e-110	367.7
LXL04_029217	`PF01453.31`	B_lectin	1274	1379	1.5e-49	167.5
LXL04_029217	`PF08276.18`	PAN_2	1504	1566	3.8e-12	46.8
LXL04_029217	`PF07714.24`	PK_Tyr_Ser-Thr	1670	1848	6.4e-75	252.5
LXL04_029217	`PF00069.32`	Pkinase	1681	1783	1.5e-70	238.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW83`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase CES101	40.771%	Swiss-Prot	weak database homology
`O64793`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520	40.378%	Swiss-Prot	weak database homology
`O81906`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase B120	39.538%	Swiss-Prot	weak database homology
`O81905`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase SD1-8	40.120%	Swiss-Prot	weak database homology
`Q39086`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase SD1-7	39.346%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card