RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G285150
Reference: TK1151 Chr: Chr07 Coordinates: 71585125-71589259 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1914 bp · TkA07G285150|TK1151|cDNA

ATGGGTTCTTGGCCGTCATCATCATCTTCACAATATAACGTGGCAGTGGTTCCTCAATTTCTCAGCTTTTTTTATTCATCTTCTTTTCTTATGGCTCGCCGATCTCACAGCACCGGATTTGAGCTAACAAAGGGTAGACTCACGCTCTTTTCAAACTCCGGCGGGTTGGGTCGGTCGTTTTGGGTAGGACCGGTTGCAACCTCAACAGGACCGGGAACTGGTCATGCGCCACGGGTGACTGCGGCACTGGTGAATAGAGT...

CDS

Download CDS FASTA

1914 bp · TkA07G285150|TK1151|CDS

ATGGGTTCTTGGCCGTCATCATCATCTTCACAATATAACGTGGCAGTGGTTCCTCAATTTCTCAGCTTTTTTTATTCATCTTCTTTTCTTATGGCTCGCCGATCTCACAGCACCGGATTTGAGCTAACAAAGGGTAGACTCACGCTCTTTTCAAACTCCGGCGGGTTGGGTCGGTCGTTTTGGGTAGGACCGGTTGCAACCTCAACAGGACCGGGAACTGGTCATGCGCCACGGGTGACTGCGGCACTGGTGAATAGAGT...

Protein

Download Protein FASTA

637 aa · TkA07G285150|TK1151|PROTEIN

MGSWPSSSSSQYNVAVVPQFLSFFYSSSFLMARRSHSTGFELTKGRLTLFSNSGGLGRSFWVGPVATSTGPGTGHAPRVTAALVNRVQWSAYYPPATFVEFIINQTHDFYHVSIVDGYNLPIIVEPIGGSGSVVRSSLALPISHRSIVAAALSQHPPRVVSPPDMLRFLNRRAQDLIEPHSMIILVHLCVMVPITQSDFCPAPDSFSTIKLGGQLNSTDQLVSIRGMFTLGFFGEGYSYLGIWYTSDVQSTKVWVANPNA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G285150
TK1151 IDTkA07G285150
OH-1004 IDLXL04_029253
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)39.100
Protein coverage (%)TK1151 100.000 / OH-1004 94.689
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G285150
LocationChr07:71585125-71589259 (-)
DescriptionSimilar to CES101: G-type lectin S-receptor-like serine/threonine-protein kinase CES101
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g11330 G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330. No verified direct reference in this release
At1g11350 Receptor-like serine/threonine-protein kinase that represses the disease resistance signaling pathway triggered in response to bacterial pathogen such as Pseudomonas syringae pv. tomato.
An S-locus receptor-like kinase plays a role as a negative regulator in plant defense responses.2009 · DOI: 10.1016/j.bbrc.2009.02.050
At1g61610 Putative G-type lectin S-receptor-like serine/threonine-protein kinase At1g61610. No verified direct reference in this release
At4g03230 G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230. No verified direct reference in this release
At4g23270 Cysteine-rich receptor-like protein kinase 19. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029253 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0006955 immune response Biological Process
GO:0007165 signal transduction Biological Process
GO:0009620 response to fungus Biological Process
GO:0045087 innate immune response Biological Process
GO:0048544 recognition of pollen Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G11300
ath:AT1G11330
ath:AT1G67520
ath:AT3G16030
ath:AT4G21390
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.559
Rank 1 · TkA07G285150 · TK1151
Endoplasmic reticulum0.161
Rank 2 · TkA07G285150 · TK1151
Nucleus0.152
Rank 3 · TkA07G285150 · TK1151
Cytoplasm0.142
Rank 4 · TkA07G285150 · TK1151
Lysosome / Vacuole0.061
Rank 5 · TkA07G285150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00314Thaumatin90-128 aa
PF01636APH150-176 aa
PF00069Pkinase403-420 aa
PF07714PK_Tyr_Ser-Thr403-423 aa
PF07714PK_Tyr_Ser-Thr430-500 aa
PF00069Pkinase442-506 aa
PF03109ABC1451-503 aa
PF01636APH457-489 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G285150PF00314Thaumatin901284.1e-0833.9
TkA07G285150PF01636APH1501760.3311.4
TkA07G285150PF00069Pkinase4034203.1e-1660.3
TkA07G285150PF07714PK_Tyr_Ser-Thr4034238.1e-1555.5
TkA07G285150PF07714PK_Tyr_Ser-Thr4305008.1e-1555.5
TkA07G285150PF00069Pkinase4425063.1e-1660.3
TkA07G285150PF03109ABC14515030.112.5
TkA07G285150PF01636APH4574890.3311.4
TkA07G285150PF12330Haspin_kinase4624950.01914.8
TkA07G285150PF11883DUF34035936372.1e-0525.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SXB8Arabidopsis thalianasp|Q9SXB8|Y1133_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g1133037.700%Swiss-ProtLow
Q9LPZ9Arabidopsis thalianasp|Q9LPZ9|SD113_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1336.700%Swiss-ProtLow
Q9SY89Arabidopsis thalianasp|Q9SY89|Y1661_ARATH Putative G-type lectin S-receptor-like serine/threonine-protein kinase At1g6161041.100%Swiss-ProtLow
Q9ZR08Arabidopsis thalianasp|Q9ZR08|Y4230_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g0323038.000%Swiss-ProtLow
Q8GWJ7Arabidopsis thalianasp|Q8GWJ7|CRK19_ARATH Cysteine-rich receptor-like protein kinase 1940.500%Swiss-ProtLow

JBrowse

View in Genome Browser