TkA07G285140 | RubberDandelionOmics

Gene overview

TkA07G285140

Reference: TK1151 Chr: Chr07 Coordinates: 71580595-71584125 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1005 bp · TkA07G285140|TK1151|cDNA

ATGACTATTCTCATCATCTTCACAATTCTATGTACCAACCTAATCATAAACTGTTTTCCGGCCACCGGTGTTTCAACGATCAAAGTCGGTGACGAACTCAACCTCACTTCTCAGCTTGTTTCCCCCACTAACAGGTTCACGTTAGGGTTCTTCAACAATCCCAACACAAGCAACAACACTTATTTAGGAATTTGGTACACCATCGATGATCAATCCAACAAAGTATGGGTCGCCAACCCATCCACACCAATCACATCCAC...

CDS

Download CDS FASTA

1005 bp · TkA07G285140|TK1151|CDS

ATGACTATTCTCATCATCTTCACAATTCTATGTACCAACCTAATCATAAACTGTTTTCCGGCCACCGGTGTTTCAACGATCAAAGTCGGTGACGAACTCAACCTCACTTCTCAGCTTGTTTCCCCCACTAACAGGTTCACGTTAGGGTTCTTCAACAATCCCAACACAAGCAACAACACTTATTTAGGAATTTGGTACACCATCGATGATCAATCCAACAAAGTATGGGTCGCCAACCCATCCACACCAATCACATCCAC...

Protein

Download Protein FASTA

334 aa · TkA07G285140|TK1151|PROTEIN

MTILIIFTILCTNLIINCFPATGVSTIKVGDELNLTSQLVSPTNRFTLGFFNNPNTSNNTYLGIWYTIDDQSNKVWVANPSTPITSTSAVLMIDPDTGKLIIATGGTTLVNISDNQSSPGSNLTATIEDTGNFQLKNQVDNRTLWQSFDHPTNVLLPGMKLGSDLRTGKSWNLTSWLSDEIPDAGAFTLNWEPIDEASQRFMMRRRGQPYWTSGNLNNQTFPYMFNLNSPSGFQYQYNLSYVYSNEERYFTFHDINGVIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G285140`
TK1151 ID	TkA07G285140
OH-1004 ID	LXL04_029217
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	60.200
Protein coverage (%)	TK1151 94.910 / OH-1004 16.640 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G285140

Location Chr07:71580595-71584125 (+)

Description Similar to CES101: G-type lectin S-receptor-like serine/threonine-protein kinase CES101

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16030`	Promotes the expression of genes involved in photosynthesis at least in dedifferentiated calli.	Arabidopsis mutants by activation tagging in which photosynthesis genes are expressed in dedifferentiated calli.2006 · DOI: 10.1093/pcp/pci242
`At1g67520`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520.	No verified direct reference in this release
`At2g19130`	G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130.	No verified direct reference in this release
`At4g21380`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029217 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009620 response to fungus Biological Process

GO:0045087 innate immune response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G67520

ath:AT3G16030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.408

Rank 1 · TkA07G285140 · TK1151

Extracellular0.305

Rank 2 · TkA07G285140 · TK1151

Endoplasmic reticulum0.122

Rank 3 · TkA07G285140 · TK1151

Cytoplasm0.089

Rank 4 · TkA07G285140 · TK1151

Lysosome / Vacuole0.044

Rank 5 · TkA07G285140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22839DUF701558-101 aa

PF01453B_lectin75-176 aa

PF22839DUF7015182-192 aa

PF22839DUF7015210-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G285140	`PF22839`	DUF7015	58	101	0.34	11.9
TkA07G285140	`PF01453`	B_lectin	75	176	2.3e-27	96.2
TkA07G285140	`PF22839`	DUF7015	182	192	0.34	11.9
TkA07G285140	`PF22839`	DUF7015	210	249	0.34	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW83`	Arabidopsis thaliana	sp\|Q9LW83\|CE101_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase CES101	34.700%	Swiss-Prot	Medium
`O64793`	Arabidopsis thaliana	sp\|O64793\|Y1675_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520	39.800%	Swiss-Prot	Medium
`O64477`	Arabidopsis thaliana	sp\|O64477\|Y2913_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130	32.200%	Swiss-Prot	Medium
`O81905`	Arabidopsis thaliana	sp\|O81905\|SD18_ARATH Receptor-like serine/threonine-protein kinase SD1-8	36.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card