TkA07G284320 | RubberDandelionOmics

Gene overview

TkA07G284320

Reference: TK1151 Chr: Chr07 Coordinates: 71327576-71328460 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

802 bp · TkA07G284320|TK1151|cDNA

AAAACAGTGGCGACAACGAGCCTTCGAAGTTTCAACATGGCTATGATGTCATCATCACCACCATTACGCGCCGGAGATATCTATCCACCTCCACCTCCAGCTCACTCCACCACCGCCAGCACTCAACTCGTAACAAAATCTCAACTTCCTCGCCGACGAGAACCTATCCATTTGTCTGAAAAAATCAATCATCTCTGCCAATTGAAAAACCTCACCGGAGCTCTGACTTTGCTCCACGTTTCCCCTCCCGAGCTCACAGA...

CDS

Download CDS FASTA

570 bp · TkA07G284320|TK1151|CDS

ATGGCTATGATGTCATCATCACCACCATTACGCGCCGGAGATATCTATCCACCTCCACCTCCAGCTCACTCCACCACCGCCAGCACTCAACTCGTAACAAAATCTCAACTTCCTCGCCGACGAGAACCTATCCATTTGTCTGAAAAAATCAATCATCTCTGCCAATTGAAAAACCTCACCGGAGCTCTGACTTTGCTCCACGTTTCCCCTCCCGAGCTCACAGAAACCGCCAAAGCAACCGGTATTCTATTGCAGGCATG...

Protein

Download Protein FASTA

189 aa · TkA07G284320|TK1151|PROTEIN

MAMMSSSPPLRAGDIYPPPPPAHSTTASTQLVTKSQLPRRREPIHLSEKINHLCQLKNLTGALTLLHVSPPELTETAKATGILLQACGGNKDIETGRKVHQLVSSSTHLRNNVILNTQIITMYSVCGSPSDSRLVFEQLQEKNLYQWNAIISGYTRNDLCLYRSFKFEMWTGGSGIGGEVKFDIGCFRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G284320`
TK1151 ID	TkA07G284320
OH-1004 ID	LXL04_030552
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.800
Protein coverage (%)	TK1151 84.127 / OH-1004 10.320 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G284320

Location Chr07:71327576-71328460 (-)

Description Similar to SPPA: Serine protease SPPA, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18485`	Pentatricopeptide repeat-containing protein At1g18485.	No verified direct reference in this release
`At2g37320`	Pentatricopeptide repeat-containing protein At2g37320.	No verified direct reference in this release
`At3g13770`	Putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial.	No verified direct reference in this release
`At3g09040`	Pentatricopeptide repeat-containing protein At3g09040, mitochondrial.	No verified direct reference in this release
`At3g21470`	Pentatricopeptide repeat-containing protein At3g21470.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030552 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0006465 signal peptide processing Biological Process

GO:0009451 RNA modification Biological Process

GO:0009642 response to light intensity Biological Process

GO:0031425 chloroplast RNA processing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G18485

ath:AT1G73990

ath:AT3G03580

ath:AT3G63370

ath:AT4G21300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.433

Rank 1 · TkA07G284320 · TK1151

Plastid0.409

Rank 2 · TkA07G284320 · TK1151

Nucleus0.070

Rank 3 · TkA07G284320 · TK1151

Cytoplasm0.035

Rank 4 · TkA07G284320 · TK1151

Cell membrane0.007

Rank 5 · TkA07G284320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01535PPR50-66 aa

PF01535PPR82-100 aa

PF01535PPR119-143 aa

PF01535PPR147-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G284320	`PF01535`	PPR	50	66	0.00022	22.0
TkA07G284320	`PF01535`	PPR	82	100	0.00022	22.0
TkA07G284320	`PF01535`	PPR	119	143	0.00022	22.0
TkA07G284320	`PF01535`	PPR	147	159	0.00022	22.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WN60`	Arabidopsis thaliana	sp\|Q0WN60\|PPR48_ARATH Pentatricopeptide repeat-containing protein At1g18485	50.000%	Swiss-Prot	Medium
`Q9ZUT4`	Arabidopsis thaliana	sp\|Q9ZUT4\|PP192_ARATH Pentatricopeptide repeat-containing protein At2g37320	32.100%	Swiss-Prot	Low
`Q9LIC3`	Arabidopsis thaliana	sp\|Q9LIC3\|PP227_ARATH Putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial	29.000%	Swiss-Prot	Low
`Q9SS83`	Arabidopsis thaliana	sp\|Q9SS83\|PP220_ARATH Pentatricopeptide repeat-containing protein At3g09040, mitochondrial	36.800%	Swiss-Prot	Low
`Q9LVF9`	Arabidopsis thaliana	sp\|Q9LVF9\|PP245_ARATH Pentatricopeptide repeat-containing protein At3g21470	36.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card