TkA07G279340 | RubberDandelionOmics

Gene overview

TkA07G279340

Reference: TK1151 Chr: Chr07 Coordinates: 69864918-69866709 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

915 bp · TkA07G279340|TK1151|cDNA

ATGGTTGCTTTTAAAAGGCTAGATCGAAGGCATGGGCAAGGCGATCCTGAGTTCTGGAAAGAGATCCTGATGCTTTCCCGTTACACACACAAAAATCTCATATCACTCCTCGGATTTTGTGACCAAGATGGTGAGAAGATCATTGTATACGAGTATGCATCAAACGGGAGTCTTGATCGACATTTAAGTAGCACTTCTCTCACGTGGAAGCAGCGCCTCAAGATATGCCTTGGGGCCGCAATGGGATTGTGCTATCTTCA...

CDS

Download CDS FASTA

915 bp · TkA07G279340|TK1151|CDS

ATGGTTGCTTTTAAAAGGCTAGATCGAAGGCATGGGCAAGGCGATCCTGAGTTCTGGAAAGAGATCCTGATGCTTTCCCGTTACACACACAAAAATCTCATATCACTCCTCGGATTTTGTGACCAAGATGGTGAGAAGATCATTGTATACGAGTATGCATCAAACGGGAGTCTTGATCGACATTTAAGTAGCACTTCTCTCACGTGGAAGCAGCGCCTCAAGATATGCCTTGGGGCCGCAATGGGATTGTGCTATCTTCA...

Protein

Download Protein FASTA

304 aa · TkA07G279340|TK1151|PROTEIN

MVAFKRLDRRHGQGDPEFWKEILMLSRYTHKNLISLLGFCDQDGEKIIVYEYASNGSLDRHLSSTSLTWKQRLKICLGAAMGLCYLHDPNETQQRVIHKNIKSSNILLDENWNAKISDMGLSKIGPVNQQYTFLVSNVVGTLEYVDPMYVEMSIFTKESDVYSFGVVLFEVLCGRLCFENNNNHFQNLVPLWKKSFKQKKLDEIIFQDLKQHMDTRSLEVFSYTAYQCLQKCRTKRPKMFDVVEKLEIALGFQEEFEETR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G279340`
TK1151 ID	TkA07G279340
OH-1004 ID	LXL04_029143
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.400
Protein coverage (%)	TK1151 84.868 / OH-1004 36.441 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G279340

Location Chr07:69864918-69866709 (-)

Description Similar to ITN1: Ankyrin repeat-containing protein ITN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029143 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT3G12360

ath:AT3G46290

ath:AT5G38990

ath:AT5G39000

dosa:Os01g0837000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.462

Rank 1 · TkA07G279340 · TK1151

Cell membrane0.432

Rank 2 · TkA07G279340 · TK1151

Nucleus0.256

Rank 3 · TkA07G279340 · TK1151

Golgi apparatus0.046

Rank 4 · TkA07G279340 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA07G279340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr2-246 aa

PF00069Pkinase2-242 aa

PF25113TPR_ESP1_2nd21-73 aa

PF16622zf-C2H2_1123-27 aa

PF30345E_spl_m650-87 aa

PF16622zf-C2H2_1152-62 aa

PF16622zf-C2H2_11173-178 aa

PF25113TPR_ESP1_2nd207-256 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G279340	`PF07714`	PK_Tyr_Ser-Thr	2	246	5.1e-36	125.0
TkA07G279340	`PF00069`	Pkinase	2	242	1.8e-35	123.3
TkA07G279340	`PF25113`	TPR_ESP1_2nd	21	73	0.0091	16.6
TkA07G279340	`PF16622`	zf-C2H2_11	23	27	1.5	9.3
TkA07G279340	`PF30345`	E_spl_m6	50	87	0.21	12.9
TkA07G279340	`PF16622`	zf-C2H2_11	52	62	1.5	9.3
TkA07G279340	`PF16622`	zf-C2H2_11	173	178	1.5	9.3
TkA07G279340	`PF25113`	TPR_ESP1_2nd	207	256	0.0091	16.6
TkA07G279340	`PF16622`	zf-C2H2_11	224	230	1.5	9.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	44.400%	Swiss-Prot	Medium
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	43.700%	Swiss-Prot	Medium
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	46.700%	Swiss-Prot	Medium
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	45.100%	Swiss-Prot	Medium
`Q9SR05`	Arabidopsis thaliana	sp\|Q9SR05\|ANX1_ARATH Receptor-like protein kinase ANXUR1	44.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card