TkA07G273970 | RubberDandelionOmics

Gene overview

TkA07G273970

Reference: TK1151 Chr: Chr07 Coordinates: 68513630-68515300 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1626 bp · TkA07G273970|TK1151|cDNA

ATGGCAATCCAATGGCTAGATGACATCGTTGAGTACTTAGAAGACCACAACGTTGCTGATGAAAGGTACACTTCTACTCTAAAAACAGCTCTAAAGCATCTCCGAGAATTACAAACCAAAGAAGAAAAGAACCGTCTTGATGGCGGCCTTTTACAGGCGGCATTAGACGGATTAGAAACCGAATTCCGGCGACTATTAACAGAAAACAGCATCCCTCTACCCATGTCTTCATCTCCATTAAACAACGAACAACCCTGCAT...

CDS

Download CDS FASTA

1626 bp · TkA07G273970|TK1151|CDS

ATGGCAATCCAATGGCTAGATGACATCGTTGAGTACTTAGAAGACCACAACGTTGCTGATGAAAGGTACACTTCTACTCTAAAAACAGCTCTAAAGCATCTCCGAGAATTACAAACCAAAGAAGAAAAGAACCGTCTTGATGGCGGCCTTTTACAGGCGGCATTAGACGGATTAGAAACCGAATTCCGGCGACTATTAACAGAAAACAGCATCCCTCTACCCATGTCTTCATCTCCATTAAACAACGAACAACCCTGCAT...

Protein

Download Protein FASTA

541 aa · TkA07G273970|TK1151|PROTEIN

MAIQWLDDIVEYLEDHNVADERYTSTLKTALKHLRELQTKEEKNRLDGGLLQAALDGLETEFRRLLTENSIPLPMSSSPLNNEQPCIAPSPLPVPIIQKLQAILGTLIANNRLEKCKSIYVDVRSSNVRASLQALNLDYLEISVSEFNDVQSIEGYIAKWSKHLEFAVKHLFEAEYKLCNDVFERLGLDVWRGCFANIAAQAGMLAFLQFGKTVTESKKDPIKLLKLLDIFASLNKLRLDFNRLFGGAACAEIQNLTRDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G273970`
TK1151 ID	TkA07G273970
OH-1004 ID	LXL04_029117
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 81.765 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G273970`
Location	Chr07:68513630-68515300 (-)
Description	Similar to EXO70A1: Exocyst complex component EXO70A1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029117` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000919 cell plate assembly Biological Process GO:0006887 exocytosis Biological Process GO:0009609 response to symbiotic bacterium Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0009630 gravitropism Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009832 plant-type cell wall biogenesis Biological Process GO:0010015 root morphogenesis Biological Process GO:0010089 xylem development Biological Process GO:0010102 lateral root morphogenesis Biological Process GO:0015031 protein transport Biological Process GO:0032502 developmental process Biological Process
KEGG gene cross-reference	ath:AT5G03540 ath:AT5G13150 ath:AT5G13990 ath:AT5G52350 mtr:11416358 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.535

Rank 1 · TkA07G273970 · TK1151

Cell membrane0.401

Rank 2 · TkA07G273970 · TK1151

Nucleus0.271

Rank 3 · TkA07G273970 · TK1151

Golgi apparatus0.061

Rank 4 · TkA07G273970 · TK1151

Lysosome / Vacuole0.051

Rank 5 · TkA07G273970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20669Exo70_N6-68 aa

PF20669Exo70_N97-117 aa

PF03081Exo70_C159-500 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G273970	`PF20669`	Exo70_N	6	68	0.00024	22.0
TkA07G273970	`PF20669`	Exo70_N	97	117	0.00024	22.0
TkA07G273970	`PF03081`	Exo70_C	159	500	1.6e-97	327.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card