LXL04_029117 | RubberDandelionOmics

Gene overview

LXL04_029117

Reference: OH-1004 Chr: Chr06 Coordinates: 81215403-81217445 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2043 bp · LXL04_029117|LXL04_029117|OH1004|cDNA

ATGGGGTCGAGTGGTGAAGAAGGGATTCGCAATTTGGTGTCTGCGAGGAACTCACTGAAGGTTAATTTAGAGAAGTCGAAAGCCCTAGGGTTATCGATACGAAAATCTGGGCCTAGATTGGAAGAGATTAATCAAAGGCTACCATGTTTAGAAGCTGCTGTTCGTCCAATTCGTGCTCAAAGAGACGCTCTTGATGCTGTCGGTGGTCATATAAACAGAGCCGTTGTCCCAGCCGCTGCTGTTTTAAAGGTGTTTGATGC...

CDS

Download CDS FASTA

2043 bp · LXL04_029117|LXL04_029117|OH1004|CDS

ATGGGGTCGAGTGGTGAAGAAGGGATTCGCAATTTGGTGTCTGCGAGGAACTCACTGAAGGTTAATTTAGAGAAGTCGAAAGCCCTAGGGTTATCGATACGAAAATCTGGGCCTAGATTGGAAGAGATTAATCAAAGGCTACCATGTTTAGAAGCTGCTGTTCGTCCAATTCGTGCTCAAAGAGACGCTCTTGATGCTGTCGGTGGTCATATAAACAGAGCCGTTGTCCCAGCCGCTGCTGTTTTAAAGGTGTTTGATGC...

Protein

Download Protein FASTA

680 aa · LXL04_029117|LXL04_029117|OH1004|PROTEIN

MGSSGEEGIRNLVSARNSLKVNLEKSKALGLSIRKSGPRLEEINQRLPCLEAAVRPIRAQRDALDAVGGHINRAVVPAAAVLKVFDAIHGLEKSLSDPQSDLQGYLSVLKNLQEALQFLSENCGMAIQWLDDIVEYLEDHNVADERYTSTLKTALKHLRELQTKEEKNRLDGGLLQAALDGLETEFRRLLTENSIPLPMSSSPLNNEQPCIAPSPLPVPIIQKLQAILGTLIANNRLEKCKSIYVDVRSSNVRASLQALN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029117`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029117

Location Chr06:81215403-81217445 (-)

Description Similar to EXO70A1: Exocyst complex component EXO70A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03540`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	AtEXO70A1, a member of a family of putative exocyst subunits specifically expanded in land plants, is important for polar growth and plant development.2006 · DOI: 10.1111/j.1365-313x.2006.02854.x Arabidopsis exocyst subunits SEC8 and EXO70A1 and exocyst interactor ROH1 are involved in the localized deposition of seed coat pectin.2010 · DOI: 10.1111/j.1469-8137.2010.03372.x The Arabidopsis exocyst complex is involved in cytokinesis and cell plate maturation.2010 · DOI: 10.1105/tpc.110.074351 The exocyst complex contributes to PIN auxin efflux carrier recycling and polar auxin transport in Arabidopsis.2013 · DOI: 10.1111/tpj.12074 EXO70A1-mediated vesicle trafficking is critical for tracheary element development in Arabidopsis.2013 · DOI: 10.1105/tpc.113.112144 Microtubule-dependent targeting of the exocyst complex is necessary for xylem development in Arabidopsis.2017 · DOI: 10.1111/nph.14267
`At5g52350`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release
`At5g13150`	Required for global plant growth and for male transmission.	Expression and functional analyses of EXO70 genes in Arabidopsis implicate their roles in regulating cell type-specific exocytosis.2010 · DOI: 10.1104/pp.110.164178 EXO70C2 Is a Key Regulatory Factor for Optimal Tip Growth of Pollen.2017 · DOI: 10.1104/pp.16.01282
`At5g13990`	Required for optimal tip growth of pollen tube.	EXO70C2 Is a Key Regulatory Factor for Optimal Tip Growth of Pollen.2017 · DOI: 10.1104/pp.16.01282 Regulation of Exocyst Function in Pollen Tube Growth by Phosphorylation of Exocyst Subunit EXO70C2.2020 · DOI: 10.3389/fpls.2020.609600

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029117 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000919 cell plate assembly Biological Process

GO:0006887 exocytosis Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009630 gravitropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0010089 xylem development Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0015031 protein transport Biological Process

GO:0032502 developmental process Biological Process

KEGG gene cross-reference

ath:AT5G03540

ath:AT5G13150

ath:AT5G13990

ath:AT5G52350

mtr:11416358

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.552

Rank 1 · LXL04_029117 · OH-1004

Cell membrane0.376

Rank 2 · LXL04_029117 · OH-1004

Nucleus0.264

Rank 3 · LXL04_029117 · OH-1004

Golgi apparatus0.069

Rank 4 · LXL04_029117 · OH-1004

Lysosome / Vacuole0.058

Rank 5 · LXL04_029117 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20669.4Exo70_N77-192 aa

PF03081.23Exo70_C283-639 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029117	`PF20669.4`	Exo70_N	77	192	5.4e-14	52.9
LXL04_029117	`PF03081.23`	Exo70_C	283	639	4e-103	346.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZD3`	Arabidopsis thaliana	Exocyst complex component EXO70A1	27.914%	Swiss-Prot	weak database homology
`F4KG58`	Arabidopsis thaliana	Exocyst complex component EXO70A3	26.196%	Swiss-Prot	weak database homology
`Q9FY95`	Arabidopsis thaliana	Exocyst complex component EXO70C1	26.490%	Swiss-Prot	weak database homology
`Q9FFX6`	Arabidopsis thaliana	Exocyst complex component EXO70C2	26.267%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card