RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G270420
Reference: TK1151 Chr: Chr07 Coordinates: 67615161-67615499 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

339 bp · TkA07G270420|TK1151|cDNA

ATGTATTCGTCTGCCCGGGTTTACGAAATCGGGCGGCGGAGACCGAACGATGACGACTCGGACCCTGATGATGCGGAAAGTGAAGAAGAAGATGAAGACGATGATGAAGATATCGATGATGATGTTTTGTTGGGGAATGATGATGGAGATATGAGTAATGAGGATAGTTTGAGTGATCTTGATGACGATGATGATGATGGTGACGATGATGATGATGATGGGGATTTTGTTATGGATGGGGTGGACTTTGGTGGGGGTGG...

CDS

Download CDS FASTA

339 bp · TkA07G270420|TK1151|CDS

ATGTATTCGTCTGCCCGGGTTTACGAAATCGGGCGGCGGAGACCGAACGATGACGACTCGGACCCTGATGATGCGGAAAGTGAAGAAGAAGATGAAGACGATGATGAAGATATCGATGATGATGTTTTGTTGGGGAATGATGATGGAGATATGAGTAATGAGGATAGTTTGAGTGATCTTGATGACGATGATGATGATGGTGACGATGATGATGATGATGGGGATTTTGTTATGGATGGGGTGGACTTTGGTGGGGGTGG...

Protein

Download Protein FASTA

112 aa · TkA07G270420|TK1151|PROTEIN

MYSSARVYEIGRRRPNDDDSDPDDAESEEEDEDDDEDIDDDVLLGNDDGDMSNEDSLSDLDDDDDDGDDDDDDGDFVMDGVDFGGGGGIFEILSDEGEEGDDDDEDDDDEDD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G270420
TK1151 IDTkA07G270420
OH-1004 IDLXL04_029076
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)96.800
Protein coverage (%)TK1151 83.929 / OH-1004 4.833
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G270420
LocationChr07:67615161-67615499 (+)
DescriptionSimilar to DCAF1: DDB1- and CUL4-associated factor homolog 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029076 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0009908 flower development Biological Process
GO:0010154 fruit development Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0035212 cell competition in a multicellular organism Biological Process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process
GO:0043687 post-translational protein modification Biological Process
GO:0045732 positive regulation of protein catabolic process Biological Process
GO:0048366 leaf development Biological Process
GO:0048367 shoot system development Biological Process
KEGG gene cross-reference
ath:AT4G31160
hsa:9730
mmu:321006
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.812
Rank 1 · TkA07G270420 · TK1151
Cytoplasm0.364
Rank 2 · TkA07G270420 · TK1151
Extracellular0.046
Rank 3 · TkA07G270420 · TK1151
Mitochondrion0.021
Rank 4 · TkA07G270420 · TK1151
Cell membrane0.018
Rank 5 · TkA07G270420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser