TkA07G251760 | RubberDandelionOmics

Gene overview

TkA07G251760

Reference: TK1151 Chr: Chr07 Coordinates: 62771687-62772875 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

930 bp · TkA07G251760|TK1151|cDNA

ATGTGGGCTCTGGTCCCTGAAGACAATGTTCAAAAGATGCTTTTGAAAGAAGAAAACAATGGTGTTCTTCTACCAGTTGTTCTAAGGGGAATTCCTGCTGAGGTTCAAGAAAGAATTGAAGCTACAGCAGTCAAGAAGCCCCAAGCAAAGAGAAAACGAAATGAACCGATTCAAACCGAATCTGTTCAAGAAGAGGAAGAAAAACCGGCTGAGACTTCTGTTCCCACTCCAAAATGGAAAAAGATAAAACAAGGGGCTAA...

CDS

Download CDS FASTA

930 bp · TkA07G251760|TK1151|CDS

ATGTGGGCTCTGGTCCCTGAAGACAATGTTCAAAAGATGCTTTTGAAAGAAGAAAACAATGGTGTTCTTCTACCAGTTGTTCTAAGGGGAATTCCTGCTGAGGTTCAAGAAAGAATTGAAGCTACAGCAGTCAAGAAGCCCCAAGCAAAGAGAAAACGAAATGAACCGATTCAAACCGAATCTGTTCAAGAAGAGGAAGAAAAACCGGCTGAGACTTCTGTTCCCACTCCAAAATGGAAAAAGATAAAACAAGGGGCTAA...

Protein

Download Protein FASTA

309 aa · TkA07G251760|TK1151|PROTEIN

MWALVPEDNVQKMLLKEENNGVLLPVVLRGIPAEVQERIEATAVKKPQAKRKRNEPIQTESVQEEEEKPAETSVPTPKWKKIKQGAKRKPSSKRQKKKKSKPALIDEQSDDEQTESDYQAEKQTEGGKEPEEEQENQSETEEEIDEEIQMEHPSGIDLSKFNQQEQIVKQHYKNVKDIRKEVLTLISTLQVDFSSKFVDVEKKTEEVSKSATDDSKLNAKLHAQEVRIKELETQLESKSHDADHKQRVLEMYKAQSQEFN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G251760`
TK1151 ID	TkA07G251760
OH-1004 ID	LXL04_003278
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	39.500
Protein coverage (%)	TK1151 100.000 / OH-1004 28.099 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G251760`
Location	Chr07:62771687-62772875 (-)
Description	Similar to ETFB: Electron transfer flavoprotein subunit beta, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_003278` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006552 L-leucine catabolic process Biological Process GO:0009063 amino acid catabolic process Biological Process GO:0015996 chlorophyll catabolic process Biological Process GO:0022904 respiratory electron transport chain Biological Process GO:0033539 fatty acid beta-oxidation using acyl-CoA dehydrogenase Biological Process GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0045251 electron transfer flavoprotein complex Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0009055 electron transfer activity Molecular Function
KEGG gene cross-reference	ath:AT5G43430 ddi:DDB_G0277991 dosa:Os04g0182800 rno:292845 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935

Rank 1 · TkA07G251760 · TK1151

Cytoplasm0.168

Rank 2 · TkA07G251760 · TK1151

Mitochondrion0.021

Rank 3 · TkA07G251760 · TK1151

Cell membrane0.016

Rank 4 · TkA07G251760 · TK1151

Extracellular0.010

Rank 5 · TkA07G251760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16808PKcGMP_CC141-146 aa

PF05531NPV_P10182-236 aa

PF16808PKcGMP_CC220-238 aa

PF05531NPV_P10265-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G251760	`PF16808`	PKcGMP_CC	141	146	0.085	13.2
TkA07G251760	`PF05531`	NPV_P10	182	236	1.8	9.8
TkA07G251760	`PF16808`	PKcGMP_CC	220	238	0.085	13.2
TkA07G251760	`PF05531`	NPV_P10	265	288	1.8	9.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card