TkA07G226620 | RubberDandelionOmics

Gene overview

TkA07G226620

Reference: TK1151 Chr: Chr07 Coordinates: 56798152-56800824 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1274 bp · TkA07G226620|TK1151|cDNA

GTTTCTCTTTATGCATTGAAACTCCAAAGAGCTAGATTGCAATCTTCCAACGTCAACAATACAATCGCATCAAGATCTGATATCCTACATCCTACTTGTTGGGCATATTATGAGCATCCGTGCCCCCTTTTGCGCCTCTGGACCTCTCCACTCCAACCTCCCGTCCAGGAATAACAATGTTGTTGGTGCCGACAATTTTGCAATTGAAAGTCATAAGATATGCTACTCAATCAACACGGAAAAGGGGAAGCTGATTCCGA...

CDS

Download CDS FASTA

786 bp · TkA07G226620|TK1151|CDS

ATGAGCATCCGTGCCCCCTTTTGCGCCTCTGGACCTCTCCACTCCAACCTCCCGTCCAGGAATAACAATGTTGTTGGTGCCGACAATTTTGCAATTGAAAGTCATAAGATATGCTACTCAATCAACACGGAAAAGGGGAAGCTGATTCCGATTCTAAACGATTGTTCCCTCAAGATTCCTTCTGGCCAGTTTTGGATGCTGCTTGGCCCTAATGGATGTGGGAAATCAACTCTTTTGAAGATCTTGGCAGGTCTGCTAAG...

Protein

Download Protein FASTA

261 aa · TkA07G226620|TK1151|PROTEIN

MSIRAPFCASGPLHSNLPSRNNNVVGADNFAIESHKICYSINTEKGKLIPILNDCSLKIPSGQFWMLLGPNGCGKSTLLKILAGLLSPTDGFVHVRKPRSFVFQNPDHQVVMPTVEADVAFGLGGFSLTNEETKFRVAKALTAVGMYDYLQRPVQTLSGGQKQRVAIAGALVQQCKVLLLDELTTFLDQTDQIGVIKAVKKTLSSCEDVSALWVTHRLEEMEYADGAVYMEDGRVVMHGKPSTIMDFIEARKASYTKTIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G226620`
TK1151 ID	TkA07G226620
OH-1004 ID	LXL04_028817
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G226620

Location Chr07:56798152-56800824 (+)

Description Similar to ABCI10: ABC transporter I family member 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33460`	ABC transporter I family member 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028817 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0043190 ATP-binding cassette (ABC) transporter complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G33460

cac:CA_C3102

cdf:CD630_01000

ctc:CTC_02576

pdc:CDIF630_00170

tte:TTE2261

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.352

Rank 1 · TkA07G226620 · TK1151

Cytoplasm0.301

Rank 2 · TkA07G226620 · TK1151

Plastid0.207

Rank 3 · TkA07G226620 · TK1151

Nucleus0.185

Rank 4 · TkA07G226620 · TK1151

Peroxisome0.039

Rank 5 · TkA07G226620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02456Adeno_IVa223-59 aa

PF00005ABC_tran52-184 aa

PF13514AAA_2753-107 aa

PF13481AAA_2559-79 aa

PF13191AAA_1660-93 aa

PF20703nSTAND161-116 aa

PF02463SMC_N62-104 aa

PF03215Rad1762-87 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G226620	`PF02456`	Adeno_IVa2	23	59	0.1	12.1
TkA07G226620	`PF00005`	ABC_tran	52	184	1.3e-29	104.3
TkA07G226620	`PF13514`	AAA_27	53	107	0.0066	16.8
TkA07G226620	`PF13481`	AAA_25	59	79	0.13	12.6
TkA07G226620	`PF13191`	AAA_16	60	93	0.25	12.6
TkA07G226620	`PF20703`	nSTAND1	61	116	0.1	12.9
TkA07G226620	`PF02463`	SMC_N	62	104	1.1e-06	28.9
TkA07G226620	`PF03215`	Rad17	62	87	0.0023	18.6
TkA07G226620	`PF13555`	AAA_29	62	89	0.0026	18.2
TkA07G226620	`PF03193`	RsgA_GTPase	62	84	0.11	13.0
TkA07G226620	`PF25199`	nSTAND_NTPase5	62	87	0.19	12.2
TkA07G226620	`PF13401`	AAA_22	63	99	0.03	15.4
TkA07G226620	`PF13175`	AAA_15	64	95	0.0088	16.3
TkA07G226620	`PF01637`	ATPase_2	64	86	0.29	11.6
TkA07G226620	`PF13173`	AAA_14	65	87	0.2	12.4
TkA07G226620	`PF13304`	AAA_21	66	133	1.8e-09	38.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1R4`	Arabidopsis thaliana	sp\|Q8H1R4\|AB10I_ARATH ABC transporter I family member 10	66.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card