Gene Card
Gene overview
cDNA / CDS / Protein Sequences
492 bp · TkA07G221560|TK1151|cDNA
ATGGGGGAAGTTGATCCAACTTTCATCCAAGAACTTGAACACAGGCCTAAACTTGCAGTACTCGAAGCCGAAGGAATCCCACAGATTGACCTCTCACCTTTCATAAACTCGACTCCCTCCGACGGTAATGATGCCACGATTGAAGATCTGATAAACCAGGTACGTGACGCATGCAAAAGTTGGGGATTTTTTGAAGTAATCAACAACGGGGTTCCCGTTGATGTCCGTGAAAAGCTACAGTCGGCGGCCAAGAGGTTTTT...
492 bp · TkA07G221560|TK1151|CDS
ATGGGGGAAGTTGATCCAACTTTCATCCAAGAACTTGAACACAGGCCTAAACTTGCAGTACTCGAAGCCGAAGGAATCCCACAGATTGACCTCTCACCTTTCATAAACTCGACTCCCTCCGACGGTAATGATGCCACGATTGAAGATCTGATAAACCAGGTACGTGACGCATGCAAAAGTTGGGGATTTTTTGAAGTAATCAACAACGGGGTTCCCGTTGATGTCCGTGAAAAGCTACAGTCGGCGGCCAAGAGGTTTTT...
Protein
Download Protein FASTA163 aa · TkA07G221560|TK1151|PROTEIN
MGEVDPTFIQELEHRPKLAVLEAEGIPQIDLSPFINSTPSDGNDATIEDLINQVRDACKSWGFFEVINNGVPVDVREKLQSAAKRFFDQILEEKKKVRRGEANPFGYYDTEHTKNVRDWKEVFDFTVEVPTLMPASYESDDEQTAEYSNQGGIGRICNNKILN
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G221560 |
|---|---|
| TK1151 ID | TkA07G221560 |
| OH-1004 ID | LXL04_001658 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 97.300 |
| Protein coverage (%) | TK1151 92.025 / OH-1004 21.216Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G221560 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:55562825-55563316 (-) | |||||||||
| Description | Similar to DLO2: Protein DMR6-LIKE OXYGENASE 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002229 defense response to oomycetes Biological Process GO:0002239 response to oomycetes Biological Process GO:0009617 response to bacterium Biological Process GO:0009620 response to fungus Biological Process GO:0009751 response to salicylic acid Biological Process GO:0010150 leaf senescence Biological Process GO:0046244 salicylic acid catabolic process Biological Process GO:0009507 chloroplast Cellular Component GO:0046872 metal ion binding Molecular Function GO:0051213 dioxygenase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT4G10490 ath:AT4G10500 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14226DIOX_N26-134 aaPF17243POTRA_TamA_145-65 aaPF25796BREX_BrxC_4th72-150 aaPF29932LdmS_C83-114 aaPF17243POTRA_TamA_184-120 aaPF29932LdmS_C131-138 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G221560 | PF14226 | DIOX_N | 26 | 134 | 2.9e-26 | 93.2 |
| TkA07G221560 | PF17243 | POTRA_TamA_1 | 45 | 65 | 0.11 | 13.3 |
| TkA07G221560 | PF25796 | BREX_BrxC_4th | 72 | 150 | 0.25 | 11.5 |
| TkA07G221560 | PF29932 | LdmS_C | 83 | 114 | 0.19 | 12.4 |
| TkA07G221560 | PF17243 | POTRA_TamA_1 | 84 | 120 | 0.11 | 13.3 |
| TkA07G221560 | PF29932 | LdmS_C | 131 | 138 | 0.19 | 12.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.