LXL04_001658 | RubberDandelionOmics

Gene overview

LXL04_001658

Reference: OH-1004 Chr: Chr01 Coordinates: 30850526-30854796 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2130 bp · LXL04_001658|LXL04_001658|OH1004|cDNA

ATGCATCATGCACAAAAACCTAACCAAATTCATAGTTTCGAAATCCAAGTGCGACGTTTACACCTCCATGATTTATATTCATCGCTTTCGGCTCTCAATTCACCAATCGACGCGACAGCCATGGGAGAAGTTGATCCAACTTTCATTCAGCAACTAGAACACAGACCTAAACTTGAAGTAACCGAAGCTCAAGGGATTCCGCAAATCGACCTCTCGCCATTGCTAAATTCGTCTGATCCGGCGGAGGTCCATGCGGATCT...

CDS

Download CDS FASTA

2124 bp · LXL04_001658|LXL04_001658|OH1004|CDS

ATGCATCATGCACAAAAACCTAACCAAATTCATAGTTTCGAAATCCAAGTGCGACGTTTACACCTCCATGATTTATATTCATCGCTTTCGGCTCTCAATTCACCAATCGACGCGACAGCCATGGGAGAAGTTGATCCAACTTTCATTCAGCAACTAGAACACAGACCTAAACTTGAAGTAACCGAAGCTCAAGGGATTCCGCAAATCGACCTCTCGCCATTGCTAAATTCGTCTGATCCGGCGGAGGTCCATGCGGATCT...

Protein

Download Protein FASTA

707 aa · LXL04_001658|LXL04_001658|OH1004|PROTEIN

MHHAQKPNQIHSFEIQVRRLHLHDLYSSLSALNSPIDATAMGEVDPTFIQQLEHRPKLEVTEAQGIPQIDLSPLLNSSDPAEVHADLVAQVREACENWGFFQVFNHGIPVESREKLMAAAKRFFNQPVEEKRKVRRDEAHPLGYYDTEHTKNVRDWKEVFDVTVDVPTMMWASHEPDDHQLTEYLNQWPHHLPELRAACEEYVKDVQKLSYKLLELIAFSLNIPANRFESFFSKGQTSFIRLNHYPPCPAPDLALGVGQH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001658`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001658

Location Chr01:30850526-30854796 (-)

Description Similar to DLO2: Protein DMR6-LIKE OXYGENASE 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10490`	Converts salicylic acid (SA) to 2,3-dihydroxybenzoic acid (2,3-DHBA) (By similarity).	DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719
`At4g10500`	Converts salicylic acid (SA) to both 2,3-dihydroxybenzoic acid (2,3-DHBA) and 2,5-DHBA in vitro but only 2,3-DHBA in vivo.	DOWNY MILDEW RESISTANT 6 and DMR6-LIKE OXYGENASE 1 are partially redundant but distinct suppressors of immunity in Arabidopsis.2015 · DOI: 10.1111/tpj.12719
`At3g21420`	Oxoglutarate-dependent dioxygenase involved in the biosynthesis of strigolactone natural products, bioactive compounds promoting plant fitness and soil microbe interactions, but preventing shoot branching.	No verified direct reference in this release
`At1g55290`	2-oxoglutarate (OG)- and Fe(II)-dependent dioxygenase (2OGD)involved in scopoletin biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001658 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0002239 response to oomycetes Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0046244 salicylic acid catabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT4G10490

ath:AT4G10500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.816

Rank 1 · LXL04_001658 · OH-1004

Nucleus0.360

Rank 2 · LXL04_001658 · OH-1004

Endoplasmic reticulum0.050

Rank 3 · LXL04_001658 · OH-1004

Mitochondrion0.044

Rank 4 · LXL04_001658 · OH-1004

Cell membrane0.041

Rank 5 · LXL04_001658 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226.13DIOX_N66-190 aa

PF03171.272OG-FeII_Oxy238-313 aa

PF14226.13DIOX_N364-491 aa

PF03171.272OG-FeII_Oxy538-637 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001658	`PF14226.13`	DIOX_N	66	190	2.8e-62	209.3
LXL04_001658	`PF03171.27`	2OG-FeII_Oxy	238	313	2.5e-60	201.8
LXL04_001658	`PF14226.13`	DIOX_N	364	491	2.8e-62	209.3
LXL04_001658	`PF03171.27`	2OG-FeII_Oxy	538	637	2.5e-60	201.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSA7`	Arabidopsis thaliana	Protein DMR6-LIKE OXYGENASE 2	35.714%	Swiss-Prot	weak database homology
`Q9ZSA8`	Arabidopsis thaliana	Protein DMR6-LIKE OXYGENASE 1	35.227%	Swiss-Prot	weak database homology
`Q9LIF4`	Arabidopsis thaliana	Protein LATERAL BRANCHING OXIDOREDUCTASE 1	37.730%	Swiss-Prot	weak database homology
`Q9C899`	Arabidopsis thaliana	Feruloyl CoA ortho-hydroxylase 2	35.542%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card