RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G161300
Reference: TK1151 Chr: Chr07 Coordinates: 41448993-41451351 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2023 bp · TkA07G161300|TK1151|cDNA

CAATTAATAAAATAGATAAAACTCGAAAACTCCCTTTCTGTTGGCCACTTATATCGAGCAAATGCAAAACTTTAAAAAGAAAAGAAAGAAAAACTCAGGCGCCGAAGACCAAATGTATCATTCCCCGTCTTCTTTCTAAAGTCTCACCGTGTTTTCATCGTCGTCGTCGTCGTCGTCGTCGTCGAACCCAACAACAAAAACCTCCACTCACAACTCACAAGCATAATTAACTCCATCGTTTTCCACAATCATCCATTCAC...

CDS

Download CDS FASTA

1221 bp · TkA07G161300|TK1151|CDS

ATGTTGGAGGGTCCGAATCCGAATATCACGGGATTGATCGGCCTAAACAGCAACTTTCAAGATACGACCCAAGGATTCTACCATAAACTCGATGACAACATGTCCATTGACAGTTTCAATAGCTTGCATATGAGCAACAATGGCGGATCAATAGCATTCTCCATCGTCAACAGTAGCGTAGACTCAAACGGCTCCAACACTCTGATGTTACCTCACCATGGTCCGAACCCATACACCGATGGCCATAGTGCTAACAACAG...

Protein

Download Protein FASTA

406 aa · TkA07G161300|TK1151|PROTEIN

MLEGPNPNITGLIGLNSNFQDTTQGFYHKLDDNMSIDSFNSLHMSNNGGSIAFSIVNSSVDSNGSNTLMLPHHGPNPYTDGHSANNRGRVAHGLTTDALAQALLDPCFPTKGLQHYEKWTIELKKLNMGPAFAQGAFGKLYKGTYNGEDVAIKLLEKPEDNLDRANLMEQQFQQEVKMLARLKHPNIVRFIGGCYKPMVWCIVTEYAKGGSVRQFLNRRQNRAVPLKLAVKQAVDVAKGMEYVHGLGLIHRDLKSDNLLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G161300
TK1151 IDTkA07G161300
OH-1004 IDLXL04_028478
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G161300
LocationChr07:41448993-41451351 (+)
DescriptionSimilar to STY13: Serine/threonine-protein kinase STY13
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g24360 Serine/threonine protein kinase that phosphorylates proteins on serine, threonine and tyrosine residues.
Genome-wide analysis and experimentation of plant serine/ threonine/tyrosine-specific protein kinases.2006 · DOI: 10.1007/s11103-005-4109-7
At1g62400 Serine/threonine/tyrosine kinase involved in the control of stomatal movement in response to CO(2). No verified direct reference in this release
At4g38470 Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).
A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200
The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
At4g35780 Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).
A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200
The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
At2g17700 Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).
A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200
The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_028478 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0007165 signal transduction Biological Process
GO:0009658 chloroplast organization Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0010119 regulation of stomatal movement Biological Process
GO:0010344 seed oilbody biogenesis Biological Process
GO:0045995 regulation of embryonic development Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0071244 cellular response to carbon dioxide Biological Process
GO:0071456 cellular response to hypoxia Biological Process
GO:0090333 regulation of stomatal closure Biological Process
GO:2000030 regulation of response to red or far red light Biological Process
KEGG gene cross-reference
ath:AT1G62400
ath:AT2G17700
ath:AT2G24360
ath:AT4G35780
ath:AT4G38470
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.517
Rank 1 · TkA07G161300 · TK1151
Cell membrane0.426
Rank 2 · TkA07G161300 · TK1151
Nucleus0.262
Rank 3 · TkA07G161300 · TK1151
Golgi apparatus0.056
Rank 4 · TkA07G161300 · TK1151
Endoplasmic reticulum0.035
Rank 5 · TkA07G161300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12330Haspin_kinase120-209 aa
PF07714PK_Tyr_Ser-Thr131-380 aa
PF03109ABC1132-155 aa
PF00069Pkinase134-378 aa
PF13095FTA2134-167 aa
PF17667Pkinase_fungal141-187 aa
PF03109ABC1171-275 aa
PF13095FTA2180-259 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G161300PF12330Haspin_kinase1202090.004616.8
TkA07G161300PF07714PK_Tyr_Ser-Thr1313806e-67226.4
TkA07G161300PF03109ABC11321550.0001421.9
TkA07G161300PF00069Pkinase1343788.1e-55186.8
TkA07G161300PF13095FTA21341670.0514.0
TkA07G161300PF17667Pkinase_fungal1411870.01215.0
TkA07G161300PF03109ABC11712750.0001421.9
TkA07G161300PF13095FTA21802590.0514.0
TkA07G161300PF17667Pkinase_fungal2423160.01215.0
TkA07G161300PF01636APH2462740.1512.5
TkA07G161300PF12330Haspin_kinase2502800.004616.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ZQ31Arabidopsis thalianasp|Q9ZQ31|STY13_ARATH Serine/threonine-protein kinase STY1368.800%Swiss-ProtHigh
Q2MHE4Arabidopsis thalianasp|Q2MHE4|HT1_ARATH Serine/threonine/tyrosine-protein kinase HT148.100%Swiss-ProtMedium
F4JTP5Arabidopsis thalianasp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY4648.700%Swiss-ProtMedium
Q8RWL6Arabidopsis thalianasp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY1743.800%Swiss-ProtMedium
O22558Arabidopsis thalianasp|O22558|STY8_ARATH Serine/threonine-protein kinase STY843.100%Swiss-ProtMedium

JBrowse

View in Genome Browser