TkA07G158260 | RubberDandelionOmics

Gene overview

TkA07G158260

Reference: TK1151 Chr: Chr07 Coordinates: 40714040-40716091 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

654 bp · TkA07G158260|TK1151|cDNA

ATGTTTGAAGTTAGAAGACGTCGTTCATATTTGCAATTGCAGGTTTCAGCGGAGACATCGATTCAATTAGGAAATTCGGCCACTTTCCATCTTCCTTCACTCTCCATCAGAGACGGAACATCGATTAAGCGAACTAGCGAAGGCTTCCCGGCTCCAGCGATTCAGAGAAAGGCGAAGATTACCCTTCTTCTCCTTCACGGCGGTCAACTCCATGTTCGTTTAGGTTTGAACTTTGGTCAGAGCGTGAGGAGCTTCAAGTT...

CDS

Download CDS FASTA

654 bp · TkA07G158260|TK1151|CDS

ATGTTTGAAGTTAGAAGACGTCGTTCATATTTGCAATTGCAGGTTTCAGCGGAGACATCGATTCAATTAGGAAATTCGGCCACTTTCCATCTTCCTTCACTCTCCATCAGAGACGGAACATCGATTAAGCGAACTAGCGAAGGCTTCCCGGCTCCAGCGATTCAGAGAAAGGCGAAGATTACCCTTCTTCTCCTTCACGGCGGTCAACTCCATGTTCGTTTAGGTTTGAACTTTGGTCAGAGCGTGAGGAGCTTCAAGTT...

Protein

Download Protein FASTA

217 aa · TkA07G158260|TK1151|PROTEIN

MFEVRRRRSYLQLQVSAETSIQLGNSATFHLPSLSIRDGTSIKRTSEGFPAPAIQRKAKITLLLLHGGQLHVRLGLNFGQSVRSFKLRLRTKKVNSHQPPSSLVIHPRDPSDADNTVKIAIINDTNTSIGSGSGSGIEMGKSHVIESGNLIISVQVQKNVTKNFSHEKELGRGGFGIIYKGQLHDGTKIAVKRMEAGVISNKALDEFQIWTKLVIKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G158260`
TK1151 ID	TkA07G158260
OH-1004 ID	LXL04_021011
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.100
Protein coverage (%)	TK1151 55.760 / OH-1004 47.082 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G158260

Location Chr07:40714040-40716091 (+)

Description Similar to TMK3: Receptor-like kinase TMK3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01820`	Involved in auxin signal transduction and cell expansion and proliferation regulation.	No verified direct reference in this release
`At1g66150`	Transmembrane kinase receptor.	The TMK1 gene from Arabidopsis codes for a protein with structural and biochemical characteristics of a receptor protein kinase.1992 · DOI: 10.1105/tpc.4.10.1263 Receptor-like kinase activity in membranes of Arabidopsis thaliana.1993 · DOI: 10.1016/0014-5793(93)80676-l
`At1g24650`	Involved in auxin signal transduction and cell expansion and proliferation regulation.	No verified direct reference in this release
`At3g23750`	Involved in auxin signal transduction and cell expansion and proliferation regulation.	Identification of Arabidopsis BAK1-associating receptor-like kinase 1 (BARK1) and characterization of its gene expression and brassinosteroid-regulated root phenotypes.2013 · DOI: 10.1093/pcp/pct106

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0448000`	Transmembrane kinase receptor involved in the regulation of reactive oxygen species (ROS) homeostasis, chloroplast development and leaf senescence.	WATER-SOAKED SPOT1 Controls Chloroplast Development and Leaf Senescence via Regulating Reactive Oxygen Species Homeostasis in Rice.2022 · DOI: 10.3389/fpls.2022.918673

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021011 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009555 pollen development Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0010600 regulation of auxin biosynthetic process Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G24650

ath:AT1G66150

ath:AT2G01820

ath:AT3G23750

ath:AT3G46290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.377

Rank 1 · TkA07G158260 · TK1151

Nucleus0.370

Rank 2 · TkA07G158260 · TK1151

Cell membrane0.232

Rank 3 · TkA07G158260 · TK1151

Endoplasmic reticulum0.087

Rank 4 · TkA07G158260 · TK1151

Mitochondrion0.068

Rank 5 · TkA07G158260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109ABC1151-205 aa

PF00069Pkinase165-212 aa

PF07714PK_Tyr_Ser-Thr166-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G158260	`PF03109`	ABC1	151	205	0.022	14.7
TkA07G158260	`PF00069`	Pkinase	165	212	0.01	16.0
TkA07G158260	`PF07714`	PK_Tyr_Ser-Thr	166	207	0.012	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIT1`	Arabidopsis thaliana	sp\|Q9SIT1\|TMK3_ARATH Receptor-like kinase TMK3	51.200%	Swiss-Prot	Medium
`P43298`	Arabidopsis thaliana	sp\|P43298\|TMK1_ARATH Receptor protein kinase TMK1	44.200%	Swiss-Prot	Medium
`Q9FYK0`	Arabidopsis thaliana	sp\|Q9FYK0\|TMK2_ARATH Receptor-like kinase TMK2	47.900%	Swiss-Prot	Medium
`Q9LK43`	Arabidopsis thaliana	sp\|Q9LK43\|TMK4_ARATH Receptor-like kinase TMK4	53.800%	Swiss-Prot	Low
`Q2R560`	Oryza sativa subsp. japonica	sp\|Q2R560\|WSS1_ORYSJ Receptor protein kinase WSS1	43.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card