LXL04_021011 | RubberDandelionOmics

Gene overview

LXL04_021011

Reference: OH-1004 Chr: Chr04 Coordinates: 118718185-118728043 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

774 bp · LXL04_021011|LXL04_021011|OH1004|cDNA

ATGGTTGACCACAGTAGTGGAGAAGTGAACGGATTCTACAGACCTCGGCGTTATACTCAaacgaccaggcaAGACAGTCGGGAGGTAGGATCCTTTCGGTATAAACCTTTCGGAAAATCCAACAACCAAGCCGAATCTGAATATTCTTGtcatcgttctcTAAACTCTCATCAACCACCAAGCTCCCTCGTTATTCATCCTCGCGACCAATCAGATGCCGACAACACAGTCAAAATTGTAATCGTCAACGACAAAAACAC...

CDS

Download CDS FASTA

774 bp · LXL04_021011|LXL04_021011|OH1004|CDS

ATGGTTGACCACAGTAGTGGAGAAGTGAACGGATTCTACAGACCTCGGCGTTATACTCAAACGACCAGGCAAGACAGTCGGGAGGTAGGATCCTTTCGGTATAAACCTTTCGGAAAATCCAACAACCAAGCCGAATCTGAATATTCTTGTCATCGTTCTCTAAACTCTCATCAACCACCAAGCTCCCTCGTTATTCATCCTCGCGACCAATCAGATGCCGACAACACAGTCAAAATTGTAATCGTCAACGACAAAAACAC...

Protein

Download Protein FASTA

257 aa · LXL04_021011|LXL04_021011|OH1004|PROTEIN

MVDHSSGEVNGFYRPRRYTQTTRQDSREVGSFRYKPFGKSNNQAESEYSCHRSLNSHQPPSSLVIHPRDQSDADNTVKIVIVNDKNTSIGSGSSSGIEMGKSHVIESGNLIISVQVLKNVTKNFSHEKELGCGGFGVIYKGQLHDGTKIAVKRIEAGVISNKALDEFQIWTKFSRRQMHTLPPLVSNCPCFRNYKVPLIYNKRAKLQKFNSMIFRNATTGWGMALNHHMIIHFHNMIIAQGIYKKRLNLNKEMEENK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021011`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021011

Location Chr04:118718185-118728043 (-)

Description Similar to TMK3: Receptor-like kinase TMK3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01820`	Involved in auxin signal transduction and cell expansion and proliferation regulation.	No verified direct reference in this release
`At1g66150`	Transmembrane kinase receptor.	The TMK1 gene from Arabidopsis codes for a protein with structural and biochemical characteristics of a receptor protein kinase.1992 · DOI: 10.1105/tpc.4.10.1263 Receptor-like kinase activity in membranes of Arabidopsis thaliana.1993 · DOI: 10.1016/0014-5793(93)80676-l
`At1g24650`	Involved in auxin signal transduction and cell expansion and proliferation regulation.	No verified direct reference in this release
`At3g23750`	Involved in auxin signal transduction and cell expansion and proliferation regulation.	Identification of Arabidopsis BAK1-associating receptor-like kinase 1 (BARK1) and characterization of its gene expression and brassinosteroid-regulated root phenotypes.2013 · DOI: 10.1093/pcp/pct106
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021011 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009555 pollen development Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0010600 regulation of auxin biosynthetic process Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G24650

ath:AT1G66150

ath:AT2G01820

ath:AT3G23750

ath:AT3G46290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.382

Rank 1 · LXL04_021011 · OH-1004

Nucleus0.358

Rank 2 · LXL04_021011 · OH-1004

Cell membrane0.221

Rank 3 · LXL04_021011 · OH-1004

Mitochondrion0.095

Rank 4 · LXL04_021011 · OH-1004

Endoplasmic reticulum0.081

Rank 5 · LXL04_021011 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIT1`	Arabidopsis thaliana	Receptor-like kinase TMK3	47.794%	Swiss-Prot	moderate database homology
`P43298`	Arabidopsis thaliana	Receptor protein kinase TMK1	45.385%	Swiss-Prot	weak database homology
`Q9FYK0`	Arabidopsis thaliana	Receptor-like kinase TMK2	45.455%	Swiss-Prot	weak database homology
`Q9LK43`	Arabidopsis thaliana	Receptor-like kinase TMK4	47.561%	Swiss-Prot	weak database homology
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	34.746%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card