RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G156820
Reference: TK1151 Chr: Chr07 Coordinates: 40259491-40268523 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3117 bp · TkA07G156820|TK1151|cDNA

GGCAAACTCCGTCCTTCCCAAGCCTACTCTCCAGTCTCCACCCACCCCATCGGCACTATAAATAAACCACCCTCTCTTCTCACCGCTACCATTTACTTCGCTCCTCTGTTCTTCTCACCTACTCTCCGCTTTTTTGCCGCAAAATCTTCCATCACTCCTCTAATCGGAATTTACTCAGCGGTTTGTGATATACAGATATGAAAGAAGATGCGCCAAATGATTTGCAAAAAAGCTATTTCGATGTGTTGGGATTATGTTGT...

CDS

Download CDS FASTA

2841 bp · TkA07G156820|TK1151|CDS

ATGAAAGAAGATGCGCCAAATGATTTGCAAAAAAGCTATTTCGATGTGTTGGGATTATGTTGTTCATCGGAGGTACCACTTATCGAGAAGATCCTTAAACCTCTTGAAGGTGTTCACCATGTCTCCGTCATCGTTCCTTCCAGAACTGTAATTGTGCTTCACGACGCGGCCCTCATTTCTCAGTTTCAAATCGTTAAGGCGCTAAACCAAGCACGATTGGAAGCAAATGTGAGGATGAAAGGAGTTCAAAGCTACGGGAA...

Protein

Download Protein FASTA

946 aa · TkA07G156820|TK1151|PROTEIN

MKEDAPNDLQKSYFDVLGLCCSSEVPLIEKILKPLEGVHHVSVIVPSRTVIVLHDAALISQFQIVKALNQARLEANVRMKGVQSYGNKWPSPYAVVCGVLLLLSFLKYVYSPFKWLALGAVAVGIIPLTLKAVASLRIFRFDINVLMLIAVGGSIFLKDYWEAGTIVFLLTISEWLETRASHKATAVMSSLMSIAPQKAVLADTGEEVNANEVKVNTRLAVKAGTMIPIDGIVVEGKCEVDEKALTGESFPVCKQVDSIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G156820
TK1151 IDTkA07G156820
OH-1004 IDLXL04_028444
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.100
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G156820
LocationChr07:40259491-40268523 (-)
DescriptionSimilar to HMA2: Cadmium/zinc-transporting ATPase HMA2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g30110 Plays an important role in zinc transport and homeostasis.
P-type ATPase heavy metal transporters with roles in essential zinc homeostasis in Arabidopsis.2004 · DOI: 10.1105/tpc.020487
At2g19110 Involved in cadmium/zinc transport. No verified direct reference in this release
UniProt: P0CW78 In a heterologous system, involved in cadmium and lead transport, but not in zinc transport. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0700700 Zinc/cadmium transporter that plays an essential role in promoting translocation of zinc and cadmium from roots to shoots.
Cadmium retention in rice roots is influenced by cadmium availability, chelation and translocation.2011 · DOI: 10.1111/j.1365-3040.2011.02299.x
Mutations in rice (Oryza sativa) heavy metal ATPase 2 (OsHMA2) restrict the translocation of zinc and cadmium.2012 · DOI: 10.1093/pcp/pcr166
The OsHMA2 transporter is involved in root-to-shoot translocation of Zn and Cd in rice.2012 · DOI: 10.1111/j.1365-3040.2012.02527.x
Preferential delivery of zinc to developing tissues in rice is mediated by P-type heavy metal ATPase OsHMA2.2013 · DOI: 10.1104/pp.113.216564
Os07g0232900 Root-specific cadmium (Cd) transporter that mediates Cd efflux in root vacuoles.
Gene limiting cadmium accumulation in rice.2010 · DOI: 10.1073/pnas.1005396107
OsHMA3, a P1B-type of ATPase affects root-to-shoot cadmium translocation in rice by mediating efflux into vacuoles.2011 · DOI: 10.1111/j.1469-8137.2010.03459.x
Overexpression of OsHMA3 enhances Cd tolerance and expression of Zn transporter genes in rice.2014 · DOI: 10.1093/jxb/eru340
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_028444 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006829 zinc ion transport Biological Process
GO:0006882 intracellular zinc ion homeostasis Biological Process
GO:0010038 response to metal ion Biological Process
GO:0010043 response to zinc ion Biological Process
GO:0015691 cadmium ion transport Biological Process
GO:0030001 metal ion transport Biological Process
GO:0032025 response to cobalt ion Biological Process
GO:0046686 response to cadmium ion Biological Process
GO:0055085 transmembrane transport Biological Process
GO:0071585 detoxification of cadmium ion Biological Process
GO:0005774 vacuolar membrane Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT2G19110
ath:AT4G30110
dosa:Os06g0700650
dosa:Os07g0232900
osa:4342783
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.321
Rank 1 · TkA07G156820 · TK1151
Cell membrane0.288
Rank 2 · TkA07G156820 · TK1151
Cytoplasm0.220
Rank 3 · TkA07G156820 · TK1151
Golgi apparatus0.163
Rank 4 · TkA07G156820 · TK1151
Lysosome / Vacuole0.120
Rank 5 · TkA07G156820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403HMA14-70 aa
PF00122E1-E2_ATPase202-292 aa
PF00702Hydrolase389-603 aa
PF00403HMA519-533 aa
PF13419HAD_2524-598 aa
PF08282Hydrolase_3526-558 aa
PF00122E1-E2_ATPase536-557 aa
PF08282Hydrolase_3584-627 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G156820PF00403HMA14700.0002122.3
TkA07G156820PF00122E1-E2_ATPase2022929.9e-2277.4
TkA07G156820PF00702Hydrolase3896036.3e-29102.4
TkA07G156820PF00403HMA5195330.0002122.3
TkA07G156820PF13419HAD_25245980.02415.3
TkA07G156820PF08282Hydrolase_35265580.1712.3
TkA07G156820PF00122E1-E2_ATPase5365579.9e-2277.4
TkA07G156820PF08282Hydrolase_35846270.1712.3
TkA07G156820PF00403HMA8258400.0002122.3
TkA07G156820PF08282Hydrolase_38628980.1712.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SZW4Arabidopsis thalianasp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA267.000%Swiss-ProtHigh
O64474Arabidopsis thalianasp|O64474|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA467.500%Swiss-ProtHigh
P0CW78Arabidopsis thalianasp|P0CW78|HMA3B_ARATH Cadmium/zinc-transporting ATPase HMA362.200%Swiss-ProtHigh
A3BF39Oryza sativa subsp. japonicasp|A3BF39|HMA2_ORYSJ Cadmium/zinc-transporting ATPase HMA262.800%Swiss-ProtHigh
Q8H384Oryza sativa subsp. japonicasp|Q8H384|HMA3_ORYSJ Cadmium/zinc-transporting ATPase HMA356.500%Swiss-ProtHigh

JBrowse

View in Genome Browser