TkA07G156620 | RubberDandelionOmics

Gene overview

TkA07G156620

Reference: TK1151 Chr: Chr07 Coordinates: 40206223-40206900 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

678 bp · TkA07G156620|TK1151|cDNA

ATGTCAATCACTGAAACATCCACCAATGCTCAATCAATTGAAATTGAGAAGAGCAAAAGGCCTAATTCATCCTTAAATATGCTTGTCCGTGCAGTTCTATTGGATAAGAAACCCGATGAGGTTCCCATGCTTGTAGAATCTGTATTAAGTAAGGTCATGGAAGAGTTTGAGAATCGTATCACTAGTCAAGTTGAACTGAAACTCGCAGCTGCTAAAGATACCCCTAATGGAAACAATACTCTTTTGAAAAGTATTTCTAA...

CDS

Download CDS FASTA

678 bp · TkA07G156620|TK1151|CDS

ATGTCAATCACTGAAACATCCACCAATGCTCAATCAATTGAAATTGAGAAGAGCAAAAGGCCTAATTCATCCTTAAATATGCTTGTCCGTGCAGTTCTATTGGATAAGAAACCCGATGAGGTTCCCATGCTTGTAGAATCTGTATTAAGTAAGGTCATGGAAGAGTTTGAGAATCGTATCACTAGTCAAGTTGAACTGAAACTCGCAGCTGCTAAAGATACCCCTAATGGAAACAATACTCTTTTGAAAAGTATTTCTAA...

Protein

Download Protein FASTA

225 aa · TkA07G156620|TK1151|PROTEIN

MSITETSTNAQSIEIEKSKRPNSSLNMLVRAVLLDKKPDEVPMLVESVLSKVMEEFENRITSQVELKLAAAKDTPNGNNTLLKSISNGIKMQDKILALVERDQNLHKKLIADEEAKRRQLKLKTAFDGQKKDITKLKQTLTITKVGMQFMQMKFLEEIQNLGLHIHGLASAASGYHRVLDKNRKLYNQVQDHIGNIRVYCPVRPPFEDEQISKVLWIALKKEQLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G156620`
TK1151 ID	TkA07G156620
OH-1004 ID	LXL04_028443
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 54.878 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G156620

Location Chr07:40206223-40206900 (+)

Description Similar to KIN14I: Kinesin-like protein KIN-14I

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47500`	Kinesin-like protein KIN-14I.	No verified direct reference in this release
`At5g27000`	Microtubule-binding motor protein.	No verified direct reference in this release
`At1g09170`	Kinesin-like protein KIN-14H.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0547500`	Minus end-directed motor protein that transports actin filaments along microtubules.	Dynamic bridges--a calponin-domain kinesin from rice links actin filaments and microtubules in both cycling and non-cycling cells.2009 · DOI: 10.1093/pcp/pcp094 A kinesin with calponin-homology domain is involved in premitotic nuclear migration.2010 · DOI: 10.1093/jxb/erq164 The non-processive rice kinesin-14 OsKCH1 transports actin filaments along microtubules with two distinct velocities.2015 · DOI: 10.1038/nplants.2015.111
`Os11g0672400`	Kinesin-like protein KIN-14P.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028443 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0007097 nuclear migration Biological Process

GO:0031534 minus-end directed microtubule sliding Biological Process

GO:0051647 nucleus localization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005874 microtubule Cellular Component

GO:0015629 actin cytoskeleton Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0003777 microtubule motor activity Molecular Function

GO:0003779 actin binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G47500

dosa:Os03g0301800

dosa:Os12g0547500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.803

Rank 1 · TkA07G156620 · TK1151

Cytoplasm0.238

Rank 2 · TkA07G156620 · TK1151

Mitochondrion0.038

Rank 3 · TkA07G156620 · TK1151

Cell membrane0.021

Rank 4 · TkA07G156620 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA07G156620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07040DUF132638-76 aa

PF16796Microtub_bd39-61 aa

PF07040DUF1326102-171 aa

PF16796Microtub_bd130-144 aa

PF16796Microtub_bd181-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G156620	`PF07040`	DUF1326	38	76	0.041	14.8
TkA07G156620	`PF16796`	Microtub_bd	39	61	2.4e-06	28.2
TkA07G156620	`PF07040`	DUF1326	102	171	0.041	14.8
TkA07G156620	`PF16796`	Microtub_bd	130	144	2.4e-06	28.2
TkA07G156620	`PF16796`	Microtub_bd	181	209	2.4e-06	28.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IL57`	Arabidopsis thaliana	sp\|F4IL57\|KN14I_ARATH Kinesin-like protein KIN-14I	55.400%	Swiss-Prot	High
`O81635`	Arabidopsis thaliana	sp\|O81635\|KN14G_ARATH Kinesin-like protein KIN-14G	40.400%	Swiss-Prot	Medium
`F4HZF0`	Arabidopsis thaliana	sp\|F4HZF0\|KN14H_ARATH Kinesin-like protein KIN-14H	37.900%	Swiss-Prot	Medium
`Q0IMS9`	Oryza sativa subsp. japonica	sp\|Q0IMS9\|KN14Q_ORYSJ Kinesin-like protein KIN-14Q	43.200%	Swiss-Prot	Medium
`B9G8P1`	Oryza sativa subsp. japonica	sp\|B9G8P1\|KN14P_ORYSJ Kinesin-like protein KIN-14P	40.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card