LXL04_028443 | RubberDandelionOmics

Gene overview

LXL04_028443

Reference: OH-1004 Chr: Chr06 Coordinates: 41900176-41901790 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1233 bp · LXL04_028443|LXL04_028443|OH1004|cDNA

ATGTCAATCACTGAAACATCCACCAATGCTCAATCAATTGAAATTGAGAAGAGCAAAAGGCCTAATTCATCCTTAAATATGCTTGTCCGTGCAGTTCTATTGGATAAGAAACCCGATGAGGTTCCCATGCTTGTAGAATCTGTATTAAGTAAGGTCATGGAAGAGTTTGAGAATCGTATCACTAGTCAAGTTGAACTGAAACTCGCAGCTGCTAAAGATACCCCTAATGGAAACAATACTCTTTTGAAAAGTATTTCTAA...

CDS

Download CDS FASTA

1233 bp · LXL04_028443|LXL04_028443|OH1004|CDS

ATGTCAATCACTGAAACATCCACCAATGCTCAATCAATTGAAATTGAGAAGAGCAAAAGGCCTAATTCATCCTTAAATATGCTTGTCCGTGCAGTTCTATTGGATAAGAAACCCGATGAGGTTCCCATGCTTGTAGAATCTGTATTAAGTAAGGTCATGGAAGAGTTTGAGAATCGTATCACTAGTCAAGTTGAACTGAAACTCGCAGCTGCTAAAGATACCCCTAATGGAAACAATACTCTTTTGAAAAGTATTTCTAA...

Protein

Download Protein FASTA

410 aa · LXL04_028443|LXL04_028443|OH1004|PROTEIN

MSITETSTNAQSIEIEKSKRPNSSLNMLVRAVLLDKKPDEVPMLVESVLSKVMEEFENRITSQVELKLAAAKDTPNGNNTLLKSISNGIKMQDKILALVERDQNLHKKLIADEEAKRRQLKLETAFDGQKKDITKLKQTLTITKVGMQFMQMKFLEEIQNLGLHIHGLASAASGYHRVLDKNRKLYNQVQDHIGNIRVYCPVRPPFEDEQISKVLWIALKKEQLPSQNGFKVPDASLVHVLSMFDVIDLMNLGHKNRVVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028443`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028443

Location Chr06:41900176-41901790 (+)

Description Similar to KIN14I: Kinesin-like protein KIN-14I

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47500`	Kinesin-like protein KIN-14I.	No verified direct reference in this release
`At5g27000`	Microtubule-binding motor protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0301800`	Kinesin-like protein KIN-14F.	No verified direct reference in this release
`Os12g0547500`	Minus end-directed motor protein that transports actin filaments along microtubules.	Dynamic bridges--a calponin-domain kinesin from rice links actin filaments and microtubules in both cycling and non-cycling cells.2009 · DOI: 10.1093/pcp/pcp094 A kinesin with calponin-homology domain is involved in premitotic nuclear migration.2010 · DOI: 10.1093/jxb/erq164 The non-processive rice kinesin-14 OsKCH1 transports actin filaments along microtubules with two distinct velocities.2015 · DOI: 10.1038/nplants.2015.111
`Os11g0672400`	Kinesin-like protein KIN-14P.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028443 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0007097 nuclear migration Biological Process

GO:0031534 minus-end directed microtubule sliding Biological Process

GO:0051647 nucleus localization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005874 microtubule Cellular Component

GO:0015629 actin cytoskeleton Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0003777 microtubule motor activity Molecular Function

GO:0003779 actin binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G47500

dosa:Os03g0301800

dosa:Os12g0547500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.659

Rank 1 · LXL04_028443 · OH-1004

Nucleus0.329

Rank 2 · LXL04_028443 · OH-1004

Mitochondrion0.075

Rank 3 · LXL04_028443 · OH-1004

Cell membrane0.057

Rank 4 · LXL04_028443 · OH-1004

Golgi apparatus0.040

Rank 5 · LXL04_028443 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796.12Microtub_bd181-209 aa

PF00225.30Kinesin226-391 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028443	`PF16796.12`	Microtub_bd	181	209	2.8e-06	28.0
LXL04_028443	`PF00225.30`	Kinesin	226	391	8.8e-57	193.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IL57`	Arabidopsis thaliana	Kinesin-like protein KIN-14I	80.978%	Swiss-Prot	weak database homology
`O81635`	Arabidopsis thaliana	Kinesin-like protein KIN-14G	75.000%	Swiss-Prot	weak database homology
`Q10MN5`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-14F	76.630%	Swiss-Prot	weak database homology
`Q0IMS9`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-14Q	74.317%	Swiss-Prot	weak database homology
`B9G8P1`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-14P	74.457%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card