TkA07G151720 | RubberDandelionOmics

Gene overview

TkA07G151720

Reference: TK1151 Chr: Chr07 Coordinates: 39024852-39031055 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3226 bp · TkA07G151720|TK1151|cDNA

ATAAAACCATGTAAAAACCCGACCCGGTTACGATTGGGATTTCCAGCTCAGCTTTGGCCCGTCCTCGGGCCTTAATGGTGTCGACTGCGCAAAAATCATAATTCTAACCTTTACTTTAACCGGAGTTTATCGGCAATCGGCGATCCCCTACCGTCTCTGATCTTTCTCTGCCCAATTTCACGCACACAACACCAGAAACATATATACGCACATAGTGATCAACAAACAGAGGTTGTTCGTCTTTGAATTTGATAAATTTT...

CDS

Download CDS FASTA

2499 bp · TkA07G151720|TK1151|CDS

ATGTGGTTTTCGTTCTGGAGATCCAAAGATCGATTCACTTTGGATGAACTCAGGTATTTAACTGACCAACTGATGAAAATTCAAGTTGTTAATGAAGTTAACAAGGATTTTGTGATAGAGGCACTGAGATCAATTGCAGAGTTGATAACATATGGCGACCAGCATGATGCCAATTTCTTTGAGTTTTTTATGGAGAAACAAATCATGGGGGAATTTGTACGGATATTAAAGATCAGTAAGAATGTGATTGTTTCAGTTCA...

Protein

Download Protein FASTA

832 aa · TkA07G151720|TK1151|PROTEIN

MWFSFWRSKDRFTLDELRYLTDQLMKIQVVNEVNKDFVIEALRSIAELITYGDQHDANFFEFFMEKQIMGEFVRILKISKNVIVSVQLLQTMSIMIQNLKSDHSIYYLFSNEHINALITYSFDFRNEELLSYYISFLRAISGKLNKNTISLLVKTQNEDVVAFPLYVEAIRFAFHEEGMIRTAVRALTLNIYHVGDVVVNKYISSNPHADYFLNLVKFFREHCISLNGMVSPTTESQGTESTSSIFSAVDEIEDNLYYLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G151720`
TK1151 ID	TkA07G151720
OH-1004 ID	LXL04_028397
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G151720

Location Chr07:39024852-39031055 (+)

Description Similar to TT9: Protein TRANSPARENT TESTA 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28430`	Involved in membrane trafficking and vacuole development through membrane fusion at the vacuole.	GFS9/TT9 contributes to intracellular membrane trafficking and flavonoid accumulation in Arabidopsis thaliana.2014 · DOI: 10.1111/tpj.12637

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028397 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000423 mitophagy Biological Process

GO:0001708 cell fate specification Biological Process

GO:0006914 autophagy Biological Process

GO:0007034 vacuolar transport Biological Process

GO:0008333 endosome to lysosome transport Biological Process

GO:0009267 cellular response to starvation Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0016197 endosomal transport Biological Process

GO:0031648 protein destabilization Biological Process

GO:0032434 regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

KEGG gene cross-reference

ath:AT3G28430

ddi:DDB_G0289943

dme:Dmel_CG12753

hsa:23274

mmu:74374

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.485

Rank 1 · TkA07G151720 · TK1151

Nucleus0.262

Rank 2 · TkA07G151720 · TK1151

Golgi apparatus0.216

Rank 3 · TkA07G151720 · TK1151

Cell membrane0.172

Rank 4 · TkA07G151720 · TK1151

Lysosome / Vacuole0.148

Rank 5 · TkA07G151720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29709CLEC16A_helical14-40 aa

PF09758FPL42-192 aa

PF29709CLEC16A_helical249-331 aa

PF09758FPL307-341 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G151720	`PF29709`	CLEC16A_helical	14	40	8.5e-05	22.2
TkA07G151720	`PF09758`	FPL	42	192	1.3e-54	185.0
TkA07G151720	`PF29709`	CLEC16A_helical	249	331	8.5e-05	22.2
TkA07G151720	`PF09758`	FPL	307	341	1.3e-54	185.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4P9`	Arabidopsis thaliana	sp\|Q8W4P9\|TT9_ARATH Protein TRANSPARENT TESTA 9	62.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card