TkA07G148660 | RubberDandelionOmics

Gene overview

TkA07G148660

Reference: TK1151 Chr: Chr07 Coordinates: 38351430-38356018 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1087 bp · TkA07G148660|TK1151|cDNA

ACCATATCAATTTTTGAAAAGTTAGACTAAAAGTGTTAAATAGAGAAAACCACATAGACCAGAACTGTAATATACTAACCCGTATATGGCCGTATCCTGTATGTGAACATTTGAATGTGAAGGCGAGTTTGTGTCCACAGATATGTGTCTCTCTAAAATCCGTAAAAATTGGAATTTAATTTCCTCATAATCATATCAATCGGAATATAGAATTCCAGTTATTGATAAAGCAACAGCAATGGGTGCAATCGCGACTCAAA...

CDS

Download CDS FASTA

720 bp · TkA07G148660|TK1151|CDS

ATGGGTGCAATCGCGACTCAAACAAGATGTTTGAAATCAACATCCATTTCTTGCTATTCATCCGACGATAAACCTTCTCCTTCACACGTTTTCCTCTCCAGAAAGAATTCAGTTTCAGATCGGCGATCGTATTTGCCGAAACAGAAATCATTTTTGATTGGAGAATTCCACATAAAGCAATTTCTCAGAATAGATTCTAATTTCACCAGGCGACAAACAAAACGCGCAGGGTTTGTGATATCACCAAGCTGTGTTCTGCC...

Protein

Download Protein FASTA

239 aa · TkA07G148660|TK1151|PROTEIN

MGAIATQTRCLKSTSISCYSSDDKPSPSHVFLSRKNSVSDRRSYLPKQKSFLIGEFHIKQFLRIDSNFTRRQTKRAGFVISPSCVLPLTEENVEKVLDEVRPGLMADGGNVALHEIDGLVVVLKLQGACGSCPSSTMTLRMGIETRLRDKIPEIMDVEQILDTETGLELNEENVEKILAEIRPYLVGTGGGILEFVEINDYSVKVRLSGPAAGVMTVRVAISQKLREKIPVITSVQLLE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G148660`
TK1151 ID	TkA07G148660
OH-1004 ID	LXL04_028382
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G148660

Location Chr07:38351430-38356018 (-)

Description Similar to NIFU3: NifU-like protein 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25910`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release
`At5g49940`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release
`At4g01940`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0176200`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028382 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0048564 photosystem I assembly Biological Process

GO:0051604 protein maturation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005198 structural molecule activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0051536 iron-sulfur cluster binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT4G01940

ath:AT4G25910

ath:AT5G49940

dosa:Os12g0176200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.972

Rank 1 · TkA07G148660 · TK1151

Mitochondrion0.043

Rank 2 · TkA07G148660 · TK1151

Nucleus0.022

Rank 3 · TkA07G148660 · TK1151

Cytoplasm0.021

Rank 4 · TkA07G148660 · TK1151

Peroxisome0.009

Rank 5 · TkA07G148660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22915ARMH586-118 aa

PF27153BrxC_ab89-105 aa

PF01106NifU93-158 aa

PF22915ARMH5140-192 aa

PF27153BrxC_ab170-182 aa

PF01968Hydantoinase_A171-220 aa

PF01106NifU174-236 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G148660	`PF22915`	ARMH5	86	118	0.11	13.7
TkA07G148660	`PF27153`	BrxC_ab	89	105	0.36	11.4
TkA07G148660	`PF01106`	NifU	93	158	1.3e-38	131.7
TkA07G148660	`PF22915`	ARMH5	140	192	0.11	13.7
TkA07G148660	`PF27153`	BrxC_ab	170	182	0.36	11.4
TkA07G148660	`PF01968`	Hydantoinase_A	171	220	0.014	15.4
TkA07G148660	`PF01106`	NifU	174	236	1.3e-38	131.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84RQ7`	Arabidopsis thaliana	sp\|Q84RQ7\|NIFU3_ARATH NifU-like protein 3, chloroplastic	62.500%	Swiss-Prot	High
`Q93W20`	Arabidopsis thaliana	sp\|Q93W20\|NIFU2_ARATH NifU-like protein 2, chloroplastic	65.200%	Swiss-Prot	High
`Q93W77`	Arabidopsis thaliana	sp\|Q93W77\|NIFU1_ARATH NifU-like protein 1, chloroplastic	39.000%	Swiss-Prot	Medium
`Q84LK7`	Oryza sativa subsp. japonica	sp\|Q84LK7\|NIFU1_ORYSJ NifU-like protein 1, chloroplastic	69.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card