LXL04_028382 | RubberDandelionOmics

Gene overview

LXL04_028382

Reference: OH-1004 Chr: Chr06 Coordinates: 39491995-39492965 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

720 bp · LXL04_028382|LXL04_028382|OH1004|cDNA

ATGGGTGCAATCGCGACTCAAACAAGATGTTTGAAATCAACATCCATTTCTTGCTATTCATCCGACGATAAACCTTCTCCTTCACACGTTTTCCTCTCCAGAAAGAATTCAGTTTCAGATCGGCGATCGTATTTGCCGAAACAGAAATCATTTTTGATTGGAGAATTCCACATAAAGCATTTTCTCAGAATAGATTCTAATTTCACCAGGCGACAAACAAAACGCGCAGGGTTCGTGATATCACCAAGTTGTGTTCTGCC...

CDS

Download CDS FASTA

720 bp · LXL04_028382|LXL04_028382|OH1004|CDS

ATGGGTGCAATCGCGACTCAAACAAGATGTTTGAAATCAACATCCATTTCTTGCTATTCATCCGACGATAAACCTTCTCCTTCACACGTTTTCCTCTCCAGAAAGAATTCAGTTTCAGATCGGCGATCGTATTTGCCGAAACAGAAATCATTTTTGATTGGAGAATTCCACATAAAGCATTTTCTCAGAATAGATTCTAATTTCACCAGGCGACAAACAAAACGCGCAGGGTTCGTGATATCACCAAGTTGTGTTCTGCC...

Protein

Download Protein FASTA

239 aa · LXL04_028382|LXL04_028382|OH1004|PROTEIN

MGAIATQTRCLKSTSISCYSSDDKPSPSHVFLSRKNSVSDRRSYLPKQKSFLIGEFHIKHFLRIDSNFTRRQTKRAGFVISPSCVLPLTEENVEKVLDEVRPGLMADGGNVALHEIDGLVVVLKLQGACGSCPSSTMTLRMGIETRLRDKIPEIMDVEQILDTETGLDLNEENVEKILAEIRPYLVGTGGGILEFAEINDYNVKVRLSGPAAGVMTVRVAISQKLREKIPVITFVQLLE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028382`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028382

Location Chr06:39491995-39492965 (-)

Description Similar to NIFU3: NifU-like protein 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25910`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release
`At5g49940`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release
`At4g01940`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0176200`	Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028382 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0048564 photosystem I assembly Biological Process

GO:0051604 protein maturation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005198 structural molecule activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0051536 iron-sulfur cluster binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT4G01940

ath:AT4G25910

ath:AT5G49940

dosa:Os12g0176200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.971

Rank 1 · LXL04_028382 · OH-1004

Mitochondrion0.043

Rank 2 · LXL04_028382 · OH-1004

Nucleus0.021

Rank 3 · LXL04_028382 · OH-1004

Cytoplasm0.020

Rank 4 · LXL04_028382 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_028382 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01106.23NifU93-158 aa

PF01106.23NifU174-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028382	`PF01106.23`	NifU	93	158	8.5e-38	129.1
LXL04_028382	`PF01106.23`	NifU	174	235	8.5e-38	129.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84RQ7`	Arabidopsis thaliana	NifU-like protein 3, chloroplastic	62.083%	Swiss-Prot	strong database homology
`Q93W20`	Arabidopsis thaliana	NifU-like protein 2, chloroplastic	64.088%	Swiss-Prot	strong database homology
`Q93W77`	Arabidopsis thaliana	NifU-like protein 1, chloroplastic	39.189%	Swiss-Prot	moderate database homology
`Q84LK7`	Oryza sativa subsp. japonica	NifU-like protein 1, chloroplastic	69.281%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card