Gene Card
Gene overview
cDNA / CDS / Protein Sequences
351 bp · TkA07G148130|TK1151|cDNA
TTCACAGGTGTTCTCAGTATTGCTGTTACCGAAGAAGGGTTTTGCTCTGCTCCGTTTATAATCGAATCCAATCTCAACCCCCAATCTCTCTATTCGAAAGTCACCGACCCTACTCTCTCGCCATCTCATCTACAAGATTTACCAGGATTTACTCGAAGTGTATATAAAAGCGATCATGCTTTAATCACTCCCGAAAGTCATGTTTTTAGCCCAGTACTCGATTGGAGCAATACACTGGGAGCCAATTTAGTCTCGCCAGC...
351 bp · TkA07G148130|TK1151|CDS
TTCACAGGTGTTCTCAGTATTGCTGTTACCGAAGAAGGGTTTTGCTCTGCTCCGTTTATAATCGAATCCAATCTCAACCCCCAATCTCTCTATTCGAAAGTCACCGACCCTACTCTCTCGCCATCTCATCTACAAGATTTACCAGGATTTACTCGAAGTGTATATAAAAGCGATCATGCTTTAATCACTCCCGAAAGTCATGTTTTTAGCCCAGTACTCGATTGGAGCAATACACTGGGAGCCAATTTAGTCTCGCCAGC...
Protein
Download Protein FASTA116 aa · TkA07G148130|TK1151|PROTEIN
FTGVLSIAVTEEGFCSAPFIIESNLNPQSLYSKVTDPTLSPSHLQDLPGFTRSVYKSDHALITPESHVFSPVLDWSNTLGANLVSPAMGAHFVIYIAKMQESSKSGLPPKHVERYS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G148130 |
|---|---|
| TK1151 ID | TkA07G148130 |
| OH-1004 ID | LXL04_026214 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 91.200 |
| Protein coverage (%) | TK1151 97.414 / OH-1004 37.049Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G148130 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:38217130-38217801 (-) | ||||||||||||
| Description | Similar to UGLYAH: (S)-ureidoglycine aminohydrolase | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000256 allantoin catabolic process Biological Process GO:0006145 purine nucleobase catabolic process Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0010136 ureide catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0003700 DNA-binding transcription factor activity Molecular Function GO:0030145 manganese ion binding Molecular Function GO:0046872 metal ion binding Molecular Function GO:0071522 ureidoglycine aminohydrolase activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT4G17050 dosa:Os07g0495000 ecj:JW0503 eco:b0515 ecoc:C3026_02525 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.