LXL04_026214 | RubberDandelionOmics

Gene overview

LXL04_026214

Reference: OH-1004 Chr: Chr05 Coordinates: 122834848-122836909 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

918 bp · LXL04_026214|LXL04_026214|OH1004|cDNA

ATGCATTATTTTTCAGCATTTTTCGCCAAGTCTTTCTTGCTTCTATCAACTATATTTGGTGTTCTCAGTATTGCTGTTACCGAAGAAGGGTTTTGCTCTGCTCCGTTTATAATCGAATCCAATTCAAACCCCCAACCTCTCTATTCGAAAGTCACCAACCCCACTCTCTCTCCATCTCATCTACAAGATTTACCAGGGTTTACTCGAAGTGTATATAAAAGCGATCATGCTTTAATCACTCCCGAAAGTCATGTTTTTAG...

CDS

Download CDS FASTA

918 bp · LXL04_026214|LXL04_026214|OH1004|CDS

ATGCATTATTTTTCAGCATTTTTCGCCAAGTCTTTCTTGCTTCTATCAACTATATTTGGTGTTCTCAGTATTGCTGTTACCGAAGAAGGGTTTTGCTCTGCTCCGTTTATAATCGAATCCAATTCAAACCCCCAACCTCTCTATTCGAAAGTCACCAACCCCACTCTCTCTCCATCTCATCTACAAGATTTACCAGGGTTTACTCGAAGTGTATATAAAAGCGATCATGCTTTAATCACTCCCGAAAGTCATGTTTTTAG...

Protein

Download Protein FASTA

305 aa · LXL04_026214|LXL04_026214|OH1004|PROTEIN

MHYFSAFFAKSFLLLSTIFGVLSIAVTEEGFCSAPFIIESNSNPQPLYSKVTNPTLSPSHLQDLPGFTRSVYKSDHALITPESHVFSPLPDWSNTLGAYLVTPAMGSHFVMYIAKMQESSKSGLPPKHVERFIFVVQGFVTLTNVSGNCKTLTVDSFAYLPPNTEHQFESYESATLVVFERRYAYLEDYIPEPIVGSTNQQPLLDTPGEVFQLRKLLPTSLPYDFNIHIMDFQPGEFLNVKEVHYNQHGLLLLEGQGIYR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026214`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026214

Location Chr05:122834848-122836909 (+)

Description Similar to UGLYAH: (S)-ureidoglycine aminohydrolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17050`	Involved in the catabolism of purine nucleotides.	Chemical basis of nitrogen recovery through the ureide pathway: formation and hydrolysis of S-ureidoglycine in plants and bacteria.2010 · DOI: 10.1021/cb900248n Structural and functional insights into (S)-ureidoglycine aminohydrolase, key enzyme of purine catabolism in Arabidopsis thaliana.2012 · DOI: 10.1074/jbc.m111.331819

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0495000`	Involved in the catabolism of purine nucleotides.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026214 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000256 allantoin catabolic process Biological Process

GO:0006145 purine nucleobase catabolic process Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010136 ureide catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0030145 manganese ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0071522 ureidoglycine aminohydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT4G17050

dosa:Os07g0495000

ecj:JW0503

eco:b0515

ecoc:C3026_02525

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.260

Rank 1 · LXL04_026214 · OH-1004

Plastid0.246

Rank 2 · LXL04_026214 · OH-1004

Cytoplasm0.170

Rank 3 · LXL04_026214 · OH-1004

Nucleus0.090

Rank 4 · LXL04_026214 · OH-1004

Mitochondrion0.090

Rank 5 · LXL04_026214 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07883.18Cupin_2128-177 aa

PF07883.18Cupin_2229-295 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026214	`PF07883.18`	Cupin_2	128	177	2.8e-14	53.3
LXL04_026214	`PF07883.18`	Cupin_2	229	295	2.8e-14	53.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXV5`	Arabidopsis thaliana	(S)-ureidoglycine aminohydrolase	73.810%	Swiss-Prot	strong database homology
`Q7F1K9`	Oryza sativa subsp. japonica	Probable (S)-ureidoglycine aminohydrolase	71.864%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card