TkA07G148110 | RubberDandelionOmics

Gene overview

TkA07G148110

Reference: TK1151 Chr: Chr07 Coordinates: 38203722-38207874 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2606 bp · TkA07G148110|TK1151|cDNA

TCGCACTCGAGTCTCGTCGTCCCTCGGTCTCTCCATCTTCCAACCAGTGGTCCAGTACCAGTGGTACGCTCTTATTTCGCACCGCCGGCCTCCAAGGCTTCGACTGCTCACCTCCGGCAATCCCTCCAGCTTCCACGTCTCCGCCTGCGGGGACCCCTCACGGCTCCATCTCCATCTCATCTCTAACTCAGGGTTTAAGATAAAGAAATCGAGAAAGGATCTCAATCTATGGAGCTGCAAATCGATGCCGATGGCACACC...

CDS

Download CDS FASTA

2169 bp · TkA07G148110|TK1151|CDS

ATGGAGCTGCAAATCGATGCCGATGGCACACCACCGCTGTCGGTGCTTGCTACTGCAAAGCTTGCAGCTGTTTCTCTGACCGTCAATCGTACATTCTCCTCCCCCTCTCCGCCCGTTCTTGTCCTAACCAACGGGCTGAAGTTACGTGGAACAAATGTACTTCTCAAGTATCTTGGTCGTACATCAACAACCATTCCCAACTTGTACCAGCGTGATGCCTATGAAACTGGACAGATTGACGAGTGGCTGGAGTATGCCCC...

Protein

Download Protein FASTA

722 aa · TkA07G148110|TK1151|PROTEIN

MELQIDADGTPPLSVLATAKLAAVSLTVNRTFSSPSPPVLVLTNGLKLRGTNVLLKYLGRTSTTIPNLYQRDAYETGQIDEWLEYAPIFSSGSEYEGACKYVDGYLLHRTFLVGHSLSVADITIWSYLAGAGKRWESLMKSKKYQNLTRWYTTISTEHAAVLNELTSTLSKKKDSSNPISSTKEKDNSNQKHIPNGSVSSNRPEVDLPHAEMGKVCLRFAPEPSGYLHIGHSKAALMNQYFAQKYNGKVIIRFDDTNPAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G148110`
TK1151 ID	TkA07G148110
OH-1004 ID	LXL04_028376
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 97.174 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G148110

Location Chr07:38203722-38207874 (-)

Description Similar to At5g26710: Glutamate--tRNA ligase, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26710`	Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028376 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006418 tRNA aminoacylation for protein translation Biological Process

GO:0006424 glutamyl-tRNA aminoacylation Biological Process

GO:0006431 methionyl-tRNA aminoacylation Biological Process

GO:0006433 prolyl-tRNA aminoacylation Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0032869 cellular response to insulin stimulus Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0071346 cellular response to type II interferon Biological Process

GO:0140212 regulation of long-chain fatty acid import into cell Biological Process

GO:1901194 negative regulation of formation of translation preinitiation complex Biological Process

KEGG gene cross-reference

ath:AT5G26710

hsa:2058

mmu:107508

sce:YGL245W

spo:2542408

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.577

Rank 1 · TkA07G148110 · TK1151

Nucleus0.364

Rank 2 · TkA07G148110 · TK1151

Mitochondrion0.178

Rank 3 · TkA07G148110 · TK1151

Peroxisome0.040

Rank 4 · TkA07G148110 · TK1151

Plastid0.028

Rank 5 · TkA07G148110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13410GST_C_298-151 aa

PF17171GST_C_698-151 aa

PF00043GST_C100-155 aa

PF14497GST_C_3101-156 aa

PF21972Arc1p_N_like104-155 aa

PF00749tRNA-synt_1c214-518 aa

PF01406tRNA-synt_1e260-322 aa

PF01196Ribosomal_L17278-335 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G148110	`PF13410`	GST_C_2	98	151	0.0054	17.5
TkA07G148110	`PF17171`	GST_C_6	98	151	0.14	12.7
TkA07G148110	`PF00043`	GST_C	100	155	0.00017	22.5
TkA07G148110	`PF14497`	GST_C_3	101	156	0.00034	21.5
TkA07G148110	`PF21972`	Arc1p_N_like	104	155	0.0091	17.0
TkA07G148110	`PF00749`	tRNA-synt_1c	214	518	3.7e-103	345.5
TkA07G148110	`PF01406`	tRNA-synt_1e	260	322	0.12	12.4
TkA07G148110	`PF01196`	Ribosomal_L17	278	335	0.12	13.9
TkA07G148110	`PF14497`	GST_C_3	285	305	0.00034	21.5
TkA07G148110	`PF01196`	Ribosomal_L17	414	427	0.12	13.9
TkA07G148110	`PF03950`	tRNA-synt_1c_C	521	610	2.8e-18	66.6
TkA07G148110	`PF20974`	tRNA-synt_1c_C2	625	698	4.6e-14	53.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82462`	Arabidopsis thaliana	sp\|O82462\|SYEC_ARATH Glutamate--tRNA ligase, cytoplasmic	69.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card