TkA07G141210 | RubberDandelionOmics

Gene overview

TkA07G141210

Reference: TK1151 Chr: Chr07 Coordinates: 36460799-36462149 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

660 bp · TkA07G141210|TK1151|cDNA

ATGTGGCCAAATATCATTGCGAAAGCAAAAGATGGAGGACTGGATGTAATCGAAACTTATGTTTTCTGGAATTACCATGAGCCTTACTACTTTAAAAGGCGGTTTGACTTAGTTAAGTTTGTGAAGACAGTACAAGAAGCTGGCATGTTTGTACATCTTCATATTGGTCCATATGCCTATGCTGAATGGAATTATGGAGGATTCCCTCTTCGGTTACATTTCATTCCTGGAATCCAATTCCATCCCACCTACACAAACTG...

CDS

Download CDS FASTA

660 bp · TkA07G141210|TK1151|CDS

ATGTGGCCAAATATCATTGCGAAAGCAAAAGATGGAGGACTGGATGTAATCGAAACTTATGTTTTCTGGAATTACCATGAGCCTTACTACTTTAAAAGGCGGTTTGACTTAGTTAAGTTTGTGAAGACAGTACAAGAAGCTGGCATGTTTGTACATCTTCATATTGGTCCATATGCCTATGCTGAATGGAATTATGGAGGATTCCCTCTTCGGTTACATTTCATTCCTGGAATCCAATTCCATCCCACCTACACAAACTG...

Protein

Download Protein FASTA

219 aa · TkA07G141210|TK1151|PROTEIN

MWPNIIAKAKDGGLDVIETYVFWNYHEPYYFKRRFDLVKFVKTVQEAGMFVHLHIGPYAYAEWNYGGFPLRLHFIPGIQFHPTYTNCTHEALRKAVCAPTGAGKTNIAMIAVLHEIGQHLKDGYLHKNEFKIVYVAPMKALAAEVTKAFSHRLAPLNMVVKELTGDMCEFQAEMKLFLAKIVNLMKVNLFHHKGTNYSSSGYSITFFWSNLDERYVYEI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G141210`
TK1151 ID	TkA07G141210
OH-1004 ID	LXL04_029354
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	58.700
Protein coverage (%)	TK1151 88.584 / OH-1004 61.064 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G141210

Location Chr07:36460799-36462149 (+)

Description Similar to BRR2C: DExH-box ATP-dependent RNA helicase DExH14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61140`	RNA helicase that plays an essential role in pre-mRNA splicing as component of the U5 snRNP and U4/U6-U5 tri-snRNP complexes.	No verified direct reference in this release
`At4g26140`	Beta-galactosidase 12.	No verified direct reference in this release
`At2g28470`	Beta-galactosidase 8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029354 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006307 DNA alkylation repair Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0008380 RNA splicing Biological Process

GO:0032790 ribosome disassembly Biological Process

GO:0071569 protein ufmylation Biological Process

GO:0072344 rescue of stalled cytosolic ribosome Biological Process

GO:0140708 CAT tailing Biological Process

GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G61140

bta:538416

hsa:10973

mmu:77987

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.401

Rank 1 · TkA07G141210 · TK1151

Nucleus0.312

Rank 2 · TkA07G141210 · TK1151

Extracellular0.149

Rank 3 · TkA07G141210 · TK1151

Mitochondrion0.107

Rank 4 · TkA07G141210 · TK1151

Endoplasmic reticulum0.107

Rank 5 · TkA07G141210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01301Glyco_hydro_351-81 aa

PF22527DEXQc_Suv382-111 aa

PF13604AAA_3087-161 aa

PF04851ResIII94-188 aa

PF00270DEAD95-169 aa

PF22527DEXQc_Suv3131-171 aa

PF01301Glyco_hydro_35169-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G141210	`PF01301`	Glyco_hydro_35	1	81	1.9e-26	94.1
TkA07G141210	`PF22527`	DEXQc_Suv3	82	111	0.17	12.1
TkA07G141210	`PF13604`	AAA_30	87	161	0.18	12.3
TkA07G141210	`PF04851`	ResIII	94	188	0.00045	20.9
TkA07G141210	`PF00270`	DEAD	95	169	4.8e-12	46.6
TkA07G141210	`PF22527`	DEXQc_Suv3	131	171	0.17	12.1
TkA07G141210	`PF01301`	Glyco_hydro_35	169	194	1.9e-26	94.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNQ1`	Arabidopsis thaliana	sp\|Q9FNQ1\|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14	83.800%	Swiss-Prot	Low
`Q9SCV0`	Arabidopsis thaliana	sp\|Q9SCV0\|BGA12_ARATH Beta-galactosidase 12	66.700%	Swiss-Prot	Low
`Q9SCV4`	Arabidopsis thaliana	sp\|Q9SCV4\|BGAL8_ARATH Beta-galactosidase 8	67.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card