LXL04_029354 | RubberDandelionOmics

Gene overview

LXL04_029354

Reference: OH-1004 Chr: Chr06 Coordinates: 88278132-88280294 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1074 bp · LXL04_029354|LXL04_029354|OH1004|cDNA

ATGGAGGGTCCAAATCGAGAGCAATTACAGTTTGTGAAATGTATTTCCCTCTATATCGCAAAGATCGGCAACAAAATCACGAGAAGTTTATTCTACACGATTGCAAGTGTTCACCACCAAAGTGTTATCAATTTCAAGATGTGGCCAGATATCATTGCGAAAGAAAAAGATGGAGGACTGGATGTAATCGAGACTTATATTTTCTGGAATTACCATACTTACATTTGTACAAAGGATCCCCTATTCGGTTACATTTCATT...

CDS

Download CDS FASTA

1074 bp · LXL04_029354|LXL04_029354|OH1004|CDS

ATGGAGGGTCCAAATCGAGAGCAATTACAGTTTGTGAAATGTATTTCCCTCTATATCGCAAAGATCGGCAACAAAATCACGAGAAGTTTATTCTACACGATTGCAAGTGTTCACCACCAAAGTGTTATCAATTTCAAGATGTGGCCAGATATCATTGCGAAAGAAAAAGATGGAGGACTGGATGTAATCGAGACTTATATTTTCTGGAATTACCATACTTACATTTGTACAAAGGATCCCCTATTCGGTTACATTTCATT...

Protein

Download Protein FASTA

357 aa · LXL04_029354|LXL04_029354|OH1004|PROTEIN

MEGPNREQLQFVKCISLYIAKIGNKITRSLFYTIASVHHQSVINFKMWPDIIAKEKDGGLDVIETYIFWNYHTYICTKDPLFGYISFLESNSIPPTQTAPMKPGEKLIEIKELDEFAQAAFQGYKSLNFIQSRIFQTTYYTNEKNLTKIRFFVVFLLKQSSCFFQVCAPTGARKTNIAMIFVLHEFGQHFKDGYLHKNEFKIVYVAPMKALAAEVTKAFSHRLAPLNMVVKELTGDMCEFHAEMKLFLAKIVNLMKENLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029354`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029354

Location Chr06:88278132-88280294 (-)

Description Similar to BRR2C: DExH-box ATP-dependent RNA helicase DExH14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61140`	RNA helicase that plays an essential role in pre-mRNA splicing as component of the U5 snRNP and U4/U6-U5 tri-snRNP complexes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029354 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006307 DNA alkylation repair Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0008380 RNA splicing Biological Process

GO:0032790 ribosome disassembly Biological Process

GO:0071569 protein ufmylation Biological Process

GO:0072344 rescue of stalled cytosolic ribosome Biological Process

GO:0140708 CAT tailing Biological Process

GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G61140

bta:538416

hsa:10973

mmu:77987

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.420

Rank 1 · LXL04_029354 · OH-1004

Nucleus0.380

Rank 2 · LXL04_029354 · OH-1004

Mitochondrion0.124

Rank 3 · LXL04_029354 · OH-1004

Endoplasmic reticulum0.098

Rank 4 · LXL04_029354 · OH-1004

Cell membrane0.077

Rank 5 · LXL04_029354 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01301.26Glyco_hydro_3532-73 aa

PF00270.36DEAD147-237 aa

PF01301.26Glyco_hydro_35239-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029354	`PF01301.26`	Glyco_hydro_35	32	73	1.2e-23	85.0
LXL04_029354	`PF00270.36`	DEAD	147	237	2.1e-08	34.8
LXL04_029354	`PF01301.26`	Glyco_hydro_35	239	320	1.2e-23	85.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNQ1`	Arabidopsis thaliana	DExH-box ATP-dependent RNA helicase DExH14	75.862%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card