TkA07G138710 | RubberDandelionOmics

Gene overview

TkA07G138710

Reference: TK1151 Chr: Chr07 Coordinates: 35906367-35907035 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

523 bp · TkA07G138710|TK1151|cDNA

ATAATATCTCAAGAAATGAAGTCTATTTTGTATATTGTTCTCATTTGTAGCCTTGTTTTAGTGGCTACTGCAACTCCAGGCACTGCCACCTTTTACCAACAATATACTCCATCTGCATGCTATGGCAACACCCCTGAGGGCGTGATGATTGCTGCAGCAAGTGATCCTTTGTGGAATGGGGGAGCCATTTGCGGAAAGATGTTCACAGTCAAATGCACCGGTGCCACAAACCCAGTCCCTCACCCTTGCTATGATGGTAA...

CDS

Download CDS FASTA

369 bp · TkA07G138710|TK1151|CDS

ATGAAGTCTATTTTGTATATTGTTCTCATTTGTAGCCTTGTTTTAGTGGCTACTGCAACTCCAGGCACTGCCACCTTTTACCAACAATATACTCCATCTGCATGCTATGGCAACACCCCTGAGGGCGTGATGATTGCTGCAGCAAGTGATCCTTTGTGGAATGGGGGAGCCATTTGCGGAAAGATGTTCACAGTCAAATGCACCGGTGCCACAAACCCAGTCCCTCACCCTTGCTATGATGGTAAAAATGTCACTGTTAA...

Protein

Download Protein FASTA

122 aa · TkA07G138710|TK1151|PROTEIN

MKSILYIVLICSLVLVATATPGTATFYQQYTPSACYGNTPEGVMIAAASDPLWNGGAICGKMFTVKCTGATNPVPHPCYDGKNVTVKVVDHCPGCGGTLDLSKEAFETIANPVAGVIKIEFW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G138710`
TK1151 ID	TkA07G138710
OH-1004 ID	LXL04_035886
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.800
Protein coverage (%)	TK1151 100.000 / OH-1004 89.706 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G138710

Location Chr07:35906367-35907035 (-)

Description Similar to EGC1: Putative EG45-like domain containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30380`	Might have a systemic role in water and solute homeostasis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035886 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009627 systemic acquired resistance Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0010230 alternative respiration Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0051428 peptide hormone receptor binding Molecular Function

KEGG gene cross-reference

ath:AT2G18660

dosa:Os03g0156000

dosa:Os03g0156300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.552

Rank 1 · TkA07G138710 · TK1151

Lysosome / Vacuole0.215

Rank 2 · TkA07G138710 · TK1151

Cytoplasm0.163

Rank 3 · TkA07G138710 · TK1151

Endoplasmic reticulum0.080

Rank 4 · TkA07G138710 · TK1151

Cell membrane0.041

Rank 5 · TkA07G138710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22514EXPB1_D125-96 aa

PF03320FBPase_glpX35-64 aa

PF29515Expansin_N37-111 aa

PF03330DPBB_146-121 aa

PF26237DUF8054_C64-68 aa

PF26237DUF8054_C90-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G138710	`PF22514`	EXPB1_D1	25	96	0.0026	18.8
TkA07G138710	`PF03320`	FBPase_glpX	35	64	0.4	10.2
TkA07G138710	`PF29515`	Expansin_N	37	111	0.38	11.6
TkA07G138710	`PF03330`	DPBB_1	46	121	6.5e-19	68.7
TkA07G138710	`PF26237`	DUF8054_C	64	68	0.0077	16.9
TkA07G138710	`PF26237`	DUF8054_C	90	107	0.0077	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0C2`	Arabidopsis thaliana	sp\|Q9M0C2\|EGC1_ARATH Putative EG45-like domain containing protein 1	68.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card