LXL04_035886 | RubberDandelionOmics

Gene overview

LXL04_035886

Reference: OH-1004 Chr: Chr08 Coordinates: 31349084-31349625 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · LXL04_035886|LXL04_035886|OH1004|cDNA

ATGCATTATCATCACAAAGAAATCATAATAATATCTCAAAAAATGAAGTCAATTTTGTGCATTGTCCTTGTTTGTAGCCTTGTTTCACTAGCTAGTGCAACTCCAGGCACAGCCACGTTTTACAACCAATATACTCCCTCTGCATGTTATGGGAACACCCCTGAGGGAGTGATGATTGCCGCCGCTAGTGATCCTTTGTGGAATGGTGGAGCCATTTGTGGAAAGATGTTCACGGTCCAATGCACCGGTGCCACAAACCC...

CDS

Download CDS FASTA

411 bp · LXL04_035886|LXL04_035886|OH1004|CDS

ATGCATTATCATCACAAAGAAATCATAATAATATCTCAAAAAATGAAGTCAATTTTGTGCATTGTCCTTGTTTGTAGCCTTGTTTCACTAGCTAGTGCAACTCCAGGCACAGCCACGTTTTACAACCAATATACTCCCTCTGCATGTTATGGGAACACCCCTGAGGGAGTGATGATTGCCGCCGCTAGTGATCCTTTGTGGAATGGTGGAGCCATTTGTGGAAAGATGTTCACGGTCCAATGCACCGGTGCCACAAACCC...

Protein

Download Protein FASTA

136 aa · LXL04_035886|LXL04_035886|OH1004|PROTEIN

MHYHHKEIIIISQKMKSILCIVLVCSLVSLASATPGTATFYNQYTPSACYGNTPEGVMIAAASDPLWNGGAICGKMFTVQCTGATNPVPHPCYDGKTVTVKVVDHCPGCGGTLDLSREAFETIANPVAGVIKIDFW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035886`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035886

Location Chr08:31349084-31349625 (-)

Description Similar to EGC1: Putative EG45-like domain containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30380`	Might have a systemic role in water and solute homeostasis.	No verified direct reference in this release
`At2g18660`	Plays a systemic role in water and solute homeostasis.	Expansin-like molecules: novel functions derived from common domains.2002 · DOI: 10.1007/s00239-001-0055-4 AtPNP-A is a systemically mobile natriuretic peptide immunoanalogue with a role in Arabidopsis thaliana cell volume regulation.2004 · DOI: 10.1016/s0014-5793(03)01384-x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0156000`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os03g0156300`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035886 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009627 systemic acquired resistance Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0010230 alternative respiration Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0051428 peptide hormone receptor binding Molecular Function

KEGG gene cross-reference

ath:AT2G18660

dosa:Os03g0156000

dosa:Os03g0156300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.416

Rank 1 · LXL04_035886 · OH-1004

Lysosome / Vacuole0.315

Rank 2 · LXL04_035886 · OH-1004

Cytoplasm0.185

Rank 3 · LXL04_035886 · OH-1004

Endoplasmic reticulum0.099

Rank 4 · LXL04_035886 · OH-1004

Nucleus0.051

Rank 5 · LXL04_035886 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03330.25DPBB_160-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035886	`PF03330.25`	DPBB_1	60	134	1.8e-18	67.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0C2`	Arabidopsis thaliana	Putative EG45-like domain containing protein 1	67.568%	Swiss-Prot	strong database homology
`Q9ZV52`	Arabidopsis thaliana	EG45-like domain containing protein 2	42.373%	Swiss-Prot	moderate database homology
`Q7G6Z5`	Oryza sativa subsp. japonica	Expansin-A19	34.058%	Swiss-Prot	moderate database homology
`Q10RK1`	Oryza sativa subsp. japonica	Expansin-A20	36.937%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card