TkA07G117480 | RubberDandelionOmics

Gene overview

TkA07G117480

Reference: TK1151 Chr: Chr07 Coordinates: 30518714-30519811 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

947 bp · TkA07G117480|TK1151|cDNA

GTAAGATTATATAACTCATAACTAATATGTTAGTGACTTCCCTTTGGAAACTACTCATCAAACTAGCTCTTTGCATCAACCGCCGCCGTGCATCTCTTCGATTCCTCTTCTACTTCACTTCGATTATTAACCGCCGCCGTACGCTGCTGCTTCTTTCCGATTTCTCCATGTTCTTGGATCGCTGTTCAACCGTGGACAAGAATTCAACGATTTAACCTCTCTTCCATTGTAAAACCCACAACCATTGTCTATTTGATTCT...

CDS

Download CDS FASTA

468 bp · TkA07G117480|TK1151|CDS

ATGGATTCAGCATCAGTGACAAAGTCCTTGGATACGCCGCTGCATGCAATCGGCTTTCAGATCGATGAGTTATCGCCACACAAGGTCACCGGTCGGCTTCAGGTCTCCGAGAAGTCATGTCAGCCGTTTAAGGTGTTACACGGGGGAGTATCGGCGTTAATATCAGAGGCGATGGCGAGTGCGGGAGCATTTGCGGCGTCGGGATGGAACAGAGTTGCCGGAGTACAGCTCAGCATCAATCACCTCAAACGTGCTGACGT...

Protein

Download Protein FASTA

155 aa · TkA07G117480|TK1151|PROTEIN

MDSASVTKSLDTPLHAIGFQIDELSPHKVTGRLQVSEKSCQPFKVLHGGVSALISEAMASAGAFAASGWNRVAGVQLSINHLKRADVGDLVFAEATPLHVGNTIQVWEVRLWKIDPRNSESRLIISTSRVTLITNLPVPDNAKDVVQSFKKYAKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G117480`
TK1151 ID	TkA07G117480
OH-1004 ID	LXL04_028069
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	94.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G117480

Location Chr07:30518714-30519811 (+)

Description Similar to DHNAT1: 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48320`	Catalyzes the hydrolysis of the thioester bond of 1,4-dihydroxy-2-naphthoyl-CoA (DHNA-CoA) in peroxisomes, a necessary step to form the naphthoquinone ring of phylloquinone (vitamin K(1)).	No verified direct reference in this release
`At5g48950`	Catalyzes the hydrolysis of the thioester bond of 1,4-dihydroxy-2-naphthoyl-CoA (DHNA-CoA) in peroxisomes, a necessary step to form the naphthoquinone ring of phylloquinone (vitamin K(1)).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028069 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009234 menaquinone biosynthetic process Biological Process

GO:0042372 phylloquinone biosynthetic process Biological Process

GO:0051289 protein homotetramerization Biological Process

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0061522 1,4-dihydroxy-2-naphthoyl-CoA thioesterase activity Molecular Function

KEGG gene cross-reference

ath:AT1G48320

ath:AT5G48950

hin:HI_1161

lmt:LMRG_02730

pmu:PM0788

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.619

Rank 1 · TkA07G117480 · TK1151

Mitochondrion0.277

Rank 2 · TkA07G117480 · TK1151

Cytoplasm0.134

Rank 3 · TkA07G117480 · TK1151

Plastid0.097

Rank 4 · TkA07G117480 · TK1151

Nucleus0.066

Rank 5 · TkA07G117480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30808DUF874616-29 aa

PF09989DUF222935-56 aa

PF030614HBT44-117 aa

PF136224HBT_345-113 aa

PF30808DUF874661-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G117480	`PF30808`	DUF8746	16	29	0.039	15.0
TkA07G117480	`PF09989`	DUF2229	35	56	0.23	11.8
TkA07G117480	`PF03061`	4HBT	44	117	5.3e-15	56.2
TkA07G117480	`PF13622`	4HBT_3	45	113	0.0027	18.6
TkA07G117480	`PF30808`	DUF8746	61	99	0.039	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX65`	Arabidopsis thaliana	sp\|Q9SX65\|DNAT1_ARATH 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1	66.000%	Swiss-Prot	High
`Q9FI76`	Arabidopsis thaliana	sp\|Q9FI76\|DNAT2_ARATH 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 2	55.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card