TkA07G115680 | RubberDandelionOmics

Gene overview

TkA07G115680

Reference: TK1151 Chr: Chr07 Coordinates: 30029754-30035964 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1422 bp · TkA07G115680|TK1151|cDNA

GTTTTTTTCTCTTCCCCAATATATTATGTATTTTATCCAGTGATCGAAATATTTGCCCATACGGAGGCCATACATTCATTCGCCCCATAGCGAAACGTACCACTTTCTTTCTCTTTCTTTCTTCACGGAATTCTTCGAGACTCCATAGCCACATACAACATCGTTTCTTTTCTTAATTAAGCATTAAGTGCTTTTCTTTGTCTTCAAGATTACATAAACACTCCAACAGTCATTCACCAGCTGACCCTTATTTTAATTTC...

CDS

Download CDS FASTA

843 bp · TkA07G115680|TK1151|CDS

ATGGCTTCAATCTATTCAATTTCTCAATCGCAGCTGTTTTCGAAGAAACCCCAGTTCATTTCCACCCAAAAAGCTTCTATATTCCCAATCTCGACCAGCTTCAGTCCGTTGAATCGTTTTGCGTTTACGTCCATGAAAATGGTCGTGGCGGCGACGGGGACGACGGCGGCGGCGGAGGCGGAGGAGAAGTCGAAGAAGAGGTATCCGGGTGAGGGAAAAGGGTTTGTGGAGGAGATGAGGTTTGTGGCTATGAAATTGCA...

Protein

Download Protein FASTA

280 aa · TkA07G115680|TK1151|PROTEIN

MASIYSISQSQLFSKKPQFISTQKASIFPISTSFSPLNRFAFTSMKMVVAATGTTAAAEAEEKSKKRYPGEGKGFVEEMRFVAMKLHTKDQSKEGEKEAQEKPLPKWEPTIDGYLKFLVDSKLVYDTLEKIVEKADFPEYAEFRNTGLERAGSLEKDLAWFKEQGHSIPEPSSPGLDYSAYVEELSKKDPQAFICHFYNTYFAHSAGGRMIGKKVAKEVLNGKELEFYKWDGDLSELLQNVRDKLNIVAESWTREEKNHC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G115680`
TK1151 ID	TkA07G115680
OH-1004 ID	LXL04_028051
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G115680

Location Chr07:30029754-30035964 (-)

Description Similar to HO1: Heme oxygenase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26670`	Key enzyme in the synthesis of the chromophore of the phytochrome family of plant photoreceptors.	Arabidopsis genomes uncoupled 5 (GUN5) mutant reveals the involvement of Mg-chelatase H subunit in plastid-to-nucleus signal transduction.2001 · DOI: 10.1073/pnas.98.4.2053 Signal transduction mutants of Arabidopsis uncouple nuclear CAB and RBCS gene expression from chloroplast development.1993 · DOI: 10.1016/0092-8674(93)90459-4
`At1g69720`	Catalyzes the opening of the heme ring to form the open-chain tetrapyrrole biliverdin IX with the release of iron and carbon monoxide (CO).	No verified direct reference in this release
`At1g58300`	Catalyzes the opening of the heme ring to form the open-chain tetrapyrrole biliverdin IX with the release of iron and carbon monoxide (CO).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0603000`	Catalyzes the opening of the heme ring to form the open-chain tetrapyrrole biliverdin IX with the release of iron and carbon monoxide (CO).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028051 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006788 heme oxidation Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009648 photoperiodism Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0009877 nodulation Biological Process

GO:0010019 chloroplast-nucleus signaling pathway Biological Process

GO:0010024 phytochromobilin biosynthetic process Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010167 response to nitrate Biological Process

GO:0010229 inflorescence development Biological Process

KEGG gene cross-reference

ath:AT1G58300

ath:AT1G69720

ath:AT2G26670

dosa:Os06g0603000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.983

Rank 1 · TkA07G115680 · TK1151

Cytoplasm0.033

Rank 2 · TkA07G115680 · TK1151

Mitochondrion0.032

Rank 3 · TkA07G115680 · TK1151

Peroxisome0.022

Rank 4 · TkA07G115680 · TK1151

Cell membrane0.019

Rank 5 · TkA07G115680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01126Heme_oxygenase84-275 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G115680	`PF01126`	Heme_oxygenase	84	275	7.8e-13	49.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48782`	Arabidopsis thaliana	sp\|O48782\|HMOX1_ARATH Heme oxygenase 1, chloroplastic	66.000%	Swiss-Prot	High
`Q9C9L4`	Arabidopsis thaliana	sp\|Q9C9L4\|HMOX3_ARATH Heme oxygenase 3, chloroplastic	73.900%	Swiss-Prot	High
`Q9LQC0`	Arabidopsis thaliana	sp\|Q9LQC0\|HMOX4_ARATH Heme oxygenase 4, chloroplastic	62.200%	Swiss-Prot	High
`Q69XJ4`	Oryza sativa subsp. japonica	sp\|Q69XJ4\|HMOX1_ORYSJ Heme oxygenase 1, chloroplastic	72.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card