TkA07G110470 | RubberDandelionOmics

Gene overview

TkA07G110470

Reference: TK1151 Chr: Chr07 Coordinates: 28602422-28604579 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1942 bp · TkA07G110470|TK1151|cDNA

AGATAAGATATTTGTATTATCTTCTGGATAAAAATAATACAAGGTTATAATAATTATTTAGCGAAGATAACATTATTGAACGATTAAATATTAAGTATGATATATCACTCATATATGTTCTTCTAGATCCTCACGTGCAATTCGTATCTCATCTTCTTCCTCGCATCGTTGAGAAAAATAAGCACAAAATTTCAAAACCCTAAAAGTTCGAACAATCTGTAAATAAAATGGATCCAGCTCCGCCGTCAACCACCAAGAGC...

CDS

Download CDS FASTA

1410 bp · TkA07G110470|TK1151|CDS

ATGGATCCAGCTCCGCCGTCAACCACCAAGAGCTGGAGCATACATACCCGCCGGGAGATCACCTGCAAGTACGAGATTCAAAACCGAATCGGATCCGGTGCCTACTCCGACGTATACAAAGCTCGCCGTCTCTCGGACGATCTTACAGTCGCATTGAAGGAAGTTCACGATTATCAATCCGCTTTCCGAGAGATCGAAGCACTTCAATCTCTACAACATTCTCCGAATGTCGTCGAGTTGCACGAGTACTTCTGGAGCGA...

Protein

Download Protein FASTA

469 aa · TkA07G110470|TK1151|PROTEIN

MDPAPPSTTKSWSIHTRREITCKYEIQNRIGSGAYSDVYKARRLSDDLTVALKEVHDYQSAFREIEALQSLQHSPNVVELHEYFWSEDEDAVLVLEYLPTDLASVIRTAKKEWKGLSVGEIKRWIIQILLAVDACHRSSIIHRDLKPANLLISANGVLKLADFGQARIRLAPGFLSVHDNTQPQVQEPSLFHQQKNIPESEPVTNEPRPHLTEPPLRTIEEYTPSYDIRPKDPIDELDKDTNFPDVDTSCLATFTTSDIE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G110470`
TK1151 ID	TkA07G110470
OH-1004 ID	LXL04_027976
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G110470

Location Chr07:28602422-28604579 (+)

Description Similar to CDKF-1: Cyclin-dependent kinase F-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28980`	CDK-activating kinase that modulates CDKD-2 and CDKD-3 activities by phosphorylation of the T-loop.	Comparison of Cak1p-like cyclin-dependent kinase-activating kinases.2002 · DOI: 10.1074/jbc.m205537200
`At1g66750`	Forms a stable complex with cyclin CYCH1-1 that phosphorylates human CDK2 and the C-terminal domain (CTD) of the large subunit of RNA polymerase II.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0334400`	Cyclin-dependent kinase F-1.	No verified direct reference in this release
`UniProt: A2YCH5`	Cyclin-dependent kinase F-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027976 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005929 cilium Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004693 cyclin-dependent protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008353 RNA polymerase II CTD heptapeptide repeat kinase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G28980

dosa:Os06g0334400

hsa:23552

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.622

Rank 1 · TkA07G110470 · TK1151

Nucleus0.568

Rank 2 · TkA07G110470 · TK1151

Cell membrane0.041

Rank 3 · TkA07G110470 · TK1151

Mitochondrion0.038

Rank 4 · TkA07G110470 · TK1151

Endoplasmic reticulum0.031

Rank 5 · TkA07G110470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26324HopBF1_kinase21-83 aa

PF00069Pkinase24-167 aa

PF07714PK_Tyr_Ser-Thr25-167 aa

PF03109ABC130-56 aa

PF03109ABC145-166 aa

PF01163RIO160-166 aa

PF06293Kdo61-179 aa

PF12330Haspin_kinase81-169 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G110470	`PF26324`	HopBF1_kinase	21	83	0.044	14.0
TkA07G110470	`PF00069`	Pkinase	24	167	1.4e-54	186.0
TkA07G110470	`PF07714`	PK_Tyr_Ser-Thr	25	167	2.3e-21	77.0
TkA07G110470	`PF03109`	ABC1	30	56	1.8e-05	24.7
TkA07G110470	`PF03109`	ABC1	45	166	1.8e-05	24.7
TkA07G110470	`PF01163`	RIO1	60	166	0.12	12.7
TkA07G110470	`PF06293`	Kdo	61	179	0.054	13.6
TkA07G110470	`PF12330`	Haspin_kinase	81	169	0.027	14.2
TkA07G110470	`PF01636`	APH	112	167	0.0029	18.1
TkA07G110470	`PF00069`	Pkinase	278	410	1.4e-54	186.0
TkA07G110470	`PF07714`	PK_Tyr_Ser-Thr	286	321	2.3e-21	77.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80345`	Arabidopsis thaliana	sp\|O80345\|CDKF1_ARATH Cyclin-dependent kinase F-1	55.500%	Swiss-Prot	High
`Q9C9M7`	Arabidopsis thaliana	sp\|Q9C9M7\|CDKD2_ARATH Cyclin-dependent kinase D-2	28.900%	Swiss-Prot	Low
`Q5Z754`	Oryza sativa subsp. japonica	sp\|Q5Z754\|CDKF1_ORYSJ Cyclin-dependent kinase F-1	50.600%	Swiss-Prot	High
`A2YCH5`	Oryza sativa subsp. indica	sp\|A2YCH5\|CDKF1_ORYSI Cyclin-dependent kinase F-1	50.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card