TkA07G092710 | RubberDandelionOmics

Gene overview

TkA07G092710

Reference: TK1151 Chr: Chr07 Coordinates: 24143882-24144570 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

438 bp · TkA07G092710|TK1151|cDNA

ATGCTGAGAAATATACCCAACAATTACACTAGGAAATTACTAGTGGAGTTGCTTGATAAACACTGTAAACAAGAAAACGAGAAGGACGAAAATGGCGTTCGATCGGCCTTCGATTTCGTATACCTTCCTGTTGATTTCAAGCATCGTTTAAATGCTGGATATGCTTTCGTAAACTTCACCACACCTGAGGCAGCTTGGAGGTTTCACAAGTCCATTAAAGGAAAACGATGGGATTTGTTTGAGAGTAAAAAGATCGCCGA...

CDS

Download CDS FASTA

438 bp · TkA07G092710|TK1151|CDS

ATGCTGAGAAATATACCCAACAATTACACTAGGAAATTACTAGTGGAGTTGCTTGATAAACACTGTAAACAAGAAAACGAGAAGGACGAAAATGGCGTTCGATCGGCCTTCGATTTCGTATACCTTCCTGTTGATTTCAAGCATCGTTTAAATGCTGGATATGCTTTCGTAAACTTCACCACACCTGAGGCAGCTTGGAGGTTTCACAAGTCCATTAAAGGAAAACGATGGGATTTGTTTGAGAGTAAAAAGATCGCCGA...

Protein

Download Protein FASTA

145 aa · TkA07G092710|TK1151|PROTEIN

MLRNIPNNYTRKLLVELLDKHCKQENEKDENGVRSAFDFVYLPVDFKHRLNAGYAFVNFTTPEAAWRFHKSIKGKRWDLFESKKIADVARAKIQGKEALVNNFEKMQLRSPSSEYLPVWFDPARDGCMASSTMKMHAIGNVENNW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G092710`
TK1151 ID	TkA07G092710
OH-1004 ID	LXL04_027764
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 53.903 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G092710

Location Chr07:24143882-24144570 (+)

Description Similar to TE1: Protein terminal ear1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WY46`	Probable RNA-binding protein.	No verified direct reference in this release
`Os01g0907900`	Probable RNA-binding protein.	PLASTOCHRON2 regulates leaf initiation and maturation in rice.2006 · DOI: 10.1105/tpc.105.037622
`Os09g0531200`	Protein MEI2-like 6.	No verified direct reference in this release
`Os02g0157900`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027764 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0045836 positive regulation of meiotic nuclear division Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0016607 nuclear speck Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

dosa:Os01g0907900

dosa:Os02g0517531

dosa:Os09g0531200

zma:541683

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.757

Rank 1 · TkA07G092710 · TK1151

Cytoplasm0.237

Rank 2 · TkA07G092710 · TK1151

Mitochondrion0.042

Rank 3 · TkA07G092710 · TK1151

Cell membrane0.041

Rank 4 · TkA07G092710 · TK1151

Endoplasmic reticulum0.021

Rank 5 · TkA07G092710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04059RRM_21-103 aa

PF00076RRM_12-20 aa

PF00076RRM_141-71 aa

PF00076RRM_180-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G092710	`PF04059`	RRM_2	1	103	2.2e-28	99.0
TkA07G092710	`PF00076`	RRM_1	2	20	0.00011	22.7
TkA07G092710	`PF00076`	RRM_1	41	71	0.00011	22.7
TkA07G092710	`PF00076`	RRM_1	80	97	0.00011	22.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2WY46`	Oryza sativa subsp. indica	sp\|A2WY46\|EAR1_ORYSI Protein terminal ear1 homolog	46.200%	Swiss-Prot	Medium
`Q0JGS5`	Oryza sativa subsp. japonica	sp\|Q0JGS5\|EAR1_ORYSJ Protein terminal ear1 homolog	46.200%	Swiss-Prot	Medium
`Q652K6`	Oryza sativa subsp. japonica	sp\|Q652K6\|OML6_ORYSJ Protein MEI2-like 6	41.600%	Swiss-Prot	Medium
`Q6ET49`	Oryza sativa subsp. japonica	sp\|Q6ET49\|OML7_ORYSJ Protein MEI2-like 7	44.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card