TkA07G085130 | RubberDandelionOmics

Gene overview

TkA07G085130

Reference: TK1151 Chr: Chr07 Coordinates: 22244520-22253663 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4287 bp · TkA07G085130|TK1151|cDNA

CTTATACACGTCAAACAAAATCTAAATATTGTTCCTTACTTCCTTACATCATTCGTAATTTAATTCATAATGAAATAAAAGATAATTCTCTTACTATAGAACCCACCAACAACCAAATATGGAGTCATGTCATCATTTCTAATCGATTAGTACGCAAGTTGGTTCATAATGGACAAGTACTACCCATAACCACATTCACGTACTGTCATTCGTTATTTATAGAAATTCCAAAATATTATCATACCTTTGCTAATTAATAT...

CDS

Download CDS FASTA

3537 bp · TkA07G085130|TK1151|CDS

ATGGTGCTCAAAACCTTCGTCCTTTTATCATTTCTTGTAATTGGTGCTCTATCAGCAGATACTAGTTTGGAAGATGAAGTTGACGCTTTGAAACATTTCAAGAACGCAATCACAGACGACCCACTTGGTGCACTCCTGGATTGGGATTCCGATTCGGATTCAATCCATCACTGCAACTGGACCGGAATCCAATGCGATGATTTGTCACAAAGTGTAGTTTCGATTTCTATTCAGCAAACATACCTCAAAGGCCAAATTTC...

Protein

Download Protein FASTA

1178 aa · TkA07G085130|TK1151|PROTEIN

MVLKTFVLLSFLVIGALSADTSLEDEVDALKHFKNAITDDPLGALLDWDSDSDSIHHCNWTGIQCDDLSQSVVSISIQQTYLKGQISPFLGNLSNLQVLDLSYNSFTGNIPSQLAYCTQLTTLSLYTNSLSGSIPLELGKLQNLQELDLGNNSLTGIIPESLCNITSMVLFSLDENKLNGTIPSRIGDLINLQFLGAFNNLLQGSVPSSIGNLKDLQALAFNQNRLSGVIPIEIGKLSNLQTLLLYNNSLSGKIPPEIGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G085130`
TK1151 ID	TkA07G085130
OH-1004 ID	LXL04_027675
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 99.745 / OH-1004 86.334 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G085130

Location Chr07:22244520-22253663 (+)

Description Similar to FLS2: LRR receptor-like serine/threonine-protein kinase FLS2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46330`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	No verified direct reference in this release
`At4g21230`	Cysteine-rich receptor-like protein kinase 27.	No verified direct reference in this release
`At1g01540`	Probable serine/threonine-protein kinase At1g01540.	No verified direct reference in this release
`At1g17230`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230.	No verified direct reference in this release
`At4g33430`	Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.	The BRI1-associated kinase 1, BAK1, has a brassinolide-independent role in plant cell-death control.2007 · DOI: 10.1016/j.cub.2007.05.046 BAK1 and BKK1 regulate brassinosteroid-dependent growth and brassinosteroid-independent cell-death pathways.2007 · DOI: 10.1016/j.cub.2007.05.036 Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216 Tyrosine phosphorylation of the BRI1 receptor kinase emerges as a component of brassinosteroid signaling in Arabidopsis.2009 · DOI: 10.1073/pnas.0810249106 Phosphorylation of receptor-like cytoplasmic kinases by bacterial flagellin.2010 · DOI: 10.4161/psb.11500 The Arabidopsis leucine-rich repeat receptor-like kinases BAK1/SERK3 and BKK1/SERK4 are required for innate immunity to hemibiotrophic and biotrophic pathogens.2011 · DOI: 10.1105/tpc.111.084301 Structure of the pseudokinase domain of BIR2, a regulator of BAK1-mediated immune signaling in Arabidopsis.2014 · DOI: 10.1016/j.jsb.2014.02.005 Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306 An RLP23-SOBIR1-BAK1 complex mediates NLP-triggered immunity.2015 · DOI: 10.1038/nplants.2015.140 The SCOOP12 peptide regulates defense response and root elongation in Arabidopsis thaliana.2019 · DOI: 10.1093/jxb/ery454 The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0618700`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	Analysis of flagellin perception mediated by flg22 receptor OsFLS2 in rice.2008 · DOI: 10.1094/mpmi-21-12-1635 Rice OsFLS2-Mediated Perception of Bacterial Flagellins Is Evaded by Xanthomonas oryzae pvs. oryzae and oryzicola.2015 · DOI: 10.1016/j.molp.2015.01.012
`UniProt: Q25AG2`	Does not seem to be involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release
`Os04g0202800`	Does not seem to be involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release
`Os06g0225300`	May be involved in regulation of plant growth through the brassinosteroid (BR) signaling pathway.	No verified direct reference in this release
`Os02g0283800`	May be involved in the regulation of plant growth through the brassinosteroid (BR) signaling pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027675 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006898 receptor-mediated endocytosis Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0016045 detection of bacterium Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045184 establishment of protein localization Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0052544 defense response by callose deposition in cell wall Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0090708 specification of plant organ axis polarity Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

KEGG gene cross-reference

ath:AT4G20140

ath:AT5G46330

dosa:Os04g0618700

osa:4337016

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.857

Rank 1 · TkA07G085130 · TK1151

Endoplasmic reticulum0.081

Rank 2 · TkA07G085130 · TK1151

Cytoplasm0.067

Rank 3 · TkA07G085130 · TK1151

Nucleus0.036

Rank 4 · TkA07G085130 · TK1151

Lysosome / Vacuole0.031

Rank 5 · TkA07G085130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_224-66 aa

PF00560LRR_173-93 aa

PF12799LRR_476-106 aa

PF29252LRR_NLRC482-173 aa

PF23598LRR_1485-222 aa

PF23211LRR_LRWD189-116 aa

PF13855LRR_890-130 aa

PF25013LRR_Zer-190-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G085130	`PF08263`	LRRNT_2	24	66	9.5e-11	42.5
TkA07G085130	`PF00560`	LRR_1	73	93	1.2e-70	218.8
TkA07G085130	`PF12799`	LRR_4	76	106	2.4e-45	152.2
TkA07G085130	`PF29252`	LRR_NLRC4	82	173	1.2	9.1
TkA07G085130	`PF23598`	LRR_14	85	222	1.2e-58	199.3
TkA07G085130	`PF23211`	LRR_LRWD1	89	116	0.18	12.2
TkA07G085130	`PF13855`	LRR_8	90	130	4.6e-57	190.4
TkA07G085130	`PF25013`	LRR_Zer-1	90	153	2.2e-14	54.5
TkA07G085130	`PF24758`	LRR_At5g56370	94	153	2.2e-10	41.3
TkA07G085130	`PF29594`	LRR_SKP2	94	167	0.036	14.0
TkA07G085130	`PF13516`	LRR_6	94	108	0.11	13.3
TkA07G085130	`PF00560`	LRR_1	95	116	1.2e-70	218.8
TkA07G085130	`PF12799`	LRR_4	95	132	2.4e-45	152.2
TkA07G085130	`PF12799`	LRR_4	118	157	2.4e-45	152.2
TkA07G085130	`PF00560`	LRR_1	119	141	1.2e-70	218.8
TkA07G085130	`PF23211`	LRR_LRWD1	135	162	0.18	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL28`	Arabidopsis thaliana	sp\|Q9FL28\|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2	54.000%	Swiss-Prot	Low
`O49564`	Arabidopsis thaliana	sp\|O49564\|CRK27_ARATH Cysteine-rich receptor-like protein kinase 27	36.500%	Swiss-Prot	Low
`Q3EDL4`	Arabidopsis thaliana	sp\|Q3EDL4\|Y1154_ARATH Probable serine/threonine-protein kinase At1g01540	37.700%	Swiss-Prot	Low
`Q9SHI2`	Arabidopsis thaliana	sp\|Q9SHI2\|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	38.600%	Swiss-Prot	Low
`Q94F62`	Arabidopsis thaliana	sp\|Q94F62\|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1	56.500%	Swiss-Prot	Low
`Q0JA29`	Oryza sativa subsp. japonica	sp\|Q0JA29\|FLS2_ORYSJ LRR receptor-like serine/threonine-protein kinase FLS2	46.900%	Swiss-Prot	Low
`Q25AG2`	Oryza sativa subsp. indica	sp\|Q25AG2\|LERK4_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK4	46.100%	Swiss-Prot	Low
`Q7FAZ0`	Oryza sativa subsp. japonica	sp\|Q7FAZ0\|LERK4_ORYSJ G-type lectin S-receptor-like serine/threonine-protein kinase LECRK4	46.100%	Swiss-Prot	Low
`Q67X31`	Oryza sativa subsp. japonica	sp\|Q67X31\|SERK3_ORYSJ LRR receptor kinase SERK2	57.400%	Swiss-Prot	Low
`Q6K4T4`	Oryza sativa subsp. japonica	sp\|Q6K4T4\|SERK4_ORYSJ LRR receptor kinase SERK2	36.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card