LXL04_027675 | RubberDandelionOmics

Gene overview

LXL04_027675

Reference: OH-1004 Chr: Chr06 Coordinates: 21636676-21647216 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4086 bp · LXL04_027675|LXL04_027675|OH1004|cDNA

ATGGTGCTCAAAACCTTCGTCCTTTTATCATTTCTTGTAATTGGTGCTCTATCAGCAGATACTAGTTTGGAAGATGAAGTTGACGCTTTGAAACATTTCAAGAACGCAATCACAGACGACCCACTTGGTGCACTCCTGGATTGGGATTCCGATTCGGATTCAATCCATCACTGCAACTGGACCGGAATCCAATGCGATGATTTGTCAAAAAGTGTAGTTTCGATTTCTATTCAGCAAACATACCTCAAAGGCCAAATTTC...

CDS

Download CDS FASTA

4086 bp · LXL04_027675|LXL04_027675|OH1004|CDS

ATGGTGCTCAAAACCTTCGTCCTTTTATCATTTCTTGTAATTGGTGCTCTATCAGCAGATACTAGTTTGGAAGATGAAGTTGACGCTTTGAAACATTTCAAGAACGCAATCACAGACGACCCACTTGGTGCACTCCTGGATTGGGATTCCGATTCGGATTCAATCCATCACTGCAACTGGACCGGAATCCAATGCGATGATTTGTCAAAAAGTGTAGTTTCGATTTCTATTCAGCAAACATACCTCAAAGGCCAAATTTC...

Protein

Download Protein FASTA

1361 aa · LXL04_027675|LXL04_027675|OH1004|PROTEIN

MVLKTFVLLSFLVIGALSADTSLEDEVDALKHFKNAITDDPLGALLDWDSDSDSIHHCNWTGIQCDDLSKSVVSISIQQTYLKGQISPFLGNLSNLQVLDLSYNSFTGNIPSQLAYCTQLTTLSLYTNSLSGSIPLELGKLQNLQELDLGNNSLTGIIPESLCNITSMVLFSLDENKLNGTIPSRIGDLINLQFLGAFNNLLQGSVPSSIGNLKDLQALAFNQNRLSGVIPIEIGKLSNLQTLLLYNNSLSGKIPPEIGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027675`
TK1151 ID	TkA07G085130
OH-1004 ID	LXL04_027675
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 99.745 / OH-1004 86.334 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027675

Location Chr06:21636676-21647216 (+)

Description Similar to FLS2: LRR receptor-like serine/threonine-protein kinase FLS2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46330`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	No verified direct reference in this release
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At5g44700`	Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0618700`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	Analysis of flagellin perception mediated by flg22 receptor OsFLS2 in rice.2008 · DOI: 10.1094/mpmi-21-12-1635 Rice OsFLS2-Mediated Perception of Bacterial Flagellins Is Evaded by Xanthomonas oryzae pvs. oryzae and oryzicola.2015 · DOI: 10.1016/j.molp.2015.01.012

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027675 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006898 receptor-mediated endocytosis Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0016045 detection of bacterium Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045184 establishment of protein localization Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0052544 defense response by callose deposition in cell wall Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0090708 specification of plant organ axis polarity Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

KEGG gene cross-reference

ath:AT4G20140

ath:AT5G46330

dosa:Os04g0618700

osa:4337016

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.825

Rank 1 · LXL04_027675 · OH-1004

Endoplasmic reticulum0.084

Rank 2 · LXL04_027675 · OH-1004

Cytoplasm0.072

Rank 3 · LXL04_027675 · OH-1004

Lysosome / Vacuole0.046

Rank 4 · LXL04_027675 · OH-1004

Nucleus0.033

Rank 5 · LXL04_027675 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_224-66 aa

PF23598.2LRR_1485-222 aa

PF13855.13LRR_890-130 aa

PF12799.14LRR_495-132 aa

PF12799.14LRR_4118-157 aa

PF13855.13LRR_8140-178 aa

PF23598.2LRR_14208-319 aa

PF12799.14LRR_4239-275 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027675	`PF08263.18`	LRRNT_2	24	66	1.1e-10	42.2
LXL04_027675	`PF23598.2`	LRR_14	85	222	2.8e-54	184.9
LXL04_027675	`PF13855.13`	LRR_8	90	130	3.2e-56	187.7
LXL04_027675	`PF12799.14`	LRR_4	95	132	2.8e-44	148.8
LXL04_027675	`PF12799.14`	LRR_4	118	157	2.8e-44	148.8
LXL04_027675	`PF13855.13`	LRR_8	140	178	3.2e-56	187.7
LXL04_027675	`PF23598.2`	LRR_14	208	319	2.8e-54	184.9
LXL04_027675	`PF12799.14`	LRR_4	239	275	2.8e-44	148.8
LXL04_027675	`PF13855.13`	LRR_8	260	298	3.2e-56	187.7
LXL04_027675	`PF23598.2`	LRR_14	325	391	2.8e-54	184.9
LXL04_027675	`PF23598.2`	LRR_14	402	537	2.8e-54	184.9
LXL04_027675	`PF13855.13`	LRR_8	407	465	3.2e-56	187.7
LXL04_027675	`PF13855.13`	LRR_8	431	489	3.2e-56	187.7
LXL04_027675	`PF13855.13`	LRR_8	478	536	3.2e-56	187.7
LXL04_027675	`PF13855.13`	LRR_8	502	562	3.2e-56	187.7
LXL04_027675	`PF23598.2`	LRR_14	545	672	2.8e-54	184.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL28`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase FLS2	48.633%	Swiss-Prot	moderate database homology
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	34.230%	Swiss-Prot	moderate database homology
`Q9FIZ3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO2	34.919%	Swiss-Prot	moderate database homology
`Q9LVP0`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g63930	34.987%	Swiss-Prot	moderate database homology
`Q0JA29`	Oryza sativa subsp. japonica	LRR receptor-like serine/threonine-protein kinase FLS2	46.704%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card