TkA07G080750 | RubberDandelionOmics

Gene overview

TkA07G080750

Reference: TK1151 Chr: Chr07 Coordinates: 21094578-21099061 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1281 bp · TkA07G080750|TK1151|cDNA

ATGTACATGCGCTATGTGTGTGTGGACAGGTATTTCATCTACAGTCATCTAGATCTCGAAACCCTAATTTGGATTGAGAAACGCGAGCCTGCATCACACGGCGCGCCCGTGCACGAAACAACAACTTCCGATGTAGATTTCTATCATACATTTGTAATTCTTCCTTGGGTGCGATTCCATCATAGGAGTTCTGGTTTGGTCGCTTATCATCCAGGCATGGTGGCTAGAACAAGGTTGCAAGTAAGGAATTCTTTAGCCAA...

CDS

Download CDS FASTA

1281 bp · TkA07G080750|TK1151|CDS

ATGTACATGCGCTATGTGTGTGTGGACAGGTATTTCATCTACAGTCATCTAGATCTCGAAACCCTAATTTGGATTGAGAAACGCGAGCCTGCATCACACGGCGCGCCCGTGCACGAAACAACAACTTCCGATGTAGATTTCTATCATACATTTGTAATTCTTCCTTGGGTGCGATTCCATCATAGGAGTTCTGGTTTGGTCGCTTATCATCCAGGCATGGTGGCTAGAACAAGGTTGCAAGTAAGGAATTCTTTAGCCAA...

Protein

Download Protein FASTA

426 aa · TkA07G080750|TK1151|PROTEIN

MYMRYVCVDRYFIYSHLDLETLIWIEKREPASHGAPVHETTTSDVDFYHTFVILPWVRFHHRSSGLVAYHPGMVARTRLQVRNSLANRKHRAIVIRHKNIRFGIVEDCKGGTSQPWPVKLMELVEHLVVADHFPSVASNTRLSDLCVVIERLHFSGFKMECPFLTKLMRTKLTLTRWSADWRNATQYYEQADLTKDFTPWDAGKHMESAGALAVELSIWNEVADFYRRASVLYNECGRSQPASDALAKGARALEDAKPEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G080750`
TK1151 ID	TkA07G080750
OH-1004 ID	LXL04_027630
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.900
Protein coverage (%)	TK1151 61.033 / OH-1004 94.118 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G080750

Location Chr07:21094578-21099061 (+)

Description Similar to GSNAP: Gamma-soluble NSF attachment protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20410`	Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027630 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0005829 cytosol Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

GO:0031201 SNARE complex Cellular Component

GO:0045335 phagocytic vesicle Cellular Component

GO:0005483 soluble NSF attachment protein activity Molecular Function

KEGG gene cross-reference

ath:AT4G20410

ddi:DDB_G0269186

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.486

Rank 1 · TkA07G080750 · TK1151

Nucleus0.306

Rank 2 · TkA07G080750 · TK1151

Mitochondrion0.124

Rank 3 · TkA07G080750 · TK1151

Golgi apparatus0.088

Rank 4 · TkA07G080750 · TK1151

Cell membrane0.088

Rank 5 · TkA07G080750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13176TPR_7178-196 aa

PF14938SNAP179-393 aa

PF13424TPR_12180-191 aa

PF13428TPR_14180-191 aa

PF07719TPR_2180-191 aa

PF00515TPR_1181-191 aa

PF13181TPR_8183-191 aa

PF13176TPR_7219-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G080750	`PF13176`	TPR_7	178	196	0.22	12.4
TkA07G080750	`PF14938`	SNAP	179	393	4.1e-11	43.6
TkA07G080750	`PF13424`	TPR_12	180	191	0.35	11.8
TkA07G080750	`PF13428`	TPR_14	180	191	0.76	11.4
TkA07G080750	`PF07719`	TPR_2	180	191	0.87	10.6
TkA07G080750	`PF00515`	TPR_1	181	191	1.5	9.4
TkA07G080750	`PF13181`	TPR_8	183	191	3.9	8.6
TkA07G080750	`PF13176`	TPR_7	219	231	0.22	12.4
TkA07G080750	`PF07719`	TPR_2	225	230	0.87	10.6
TkA07G080750	`PF13428`	TPR_14	227	255	0.76	11.4
TkA07G080750	`PF13181`	TPR_8	228	246	3.9	8.6
TkA07G080750	`PF13424`	TPR_12	249	274	0.35	11.8
TkA07G080750	`PF13428`	TPR_14	251	273	0.76	11.4
TkA07G080750	`PF13176`	TPR_7	257	271	0.22	12.4
TkA07G080750	`PF13424`	TPR_12	257	274	0.35	11.8
TkA07G080750	`PF07719`	TPR_2	257	272	0.87	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SPE5`	Arabidopsis thaliana	sp\|Q9SPE5\|SNAG_ARATH Gamma-soluble NSF attachment protein	66.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card